KEGG   Thermovirga lienii: Tlie_1914Help
Entry
Tlie_1914         CDS       T01644                                 

Definition
tungsten-dependent aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tli  Thermovirga lienii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tli01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tli00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pTLIE01:complement(29913..31718)
Genome map
AA seq 601 aa AA seqDB search
MAFEIKLLKVNLTEKKVETEVLGEDIAKRWIGGRGLGAYLMLRAKASKVDPLGPENPLIF
APGPLSGTSAPTGGRYNVVTKSPTTGFIAFANSGGYFGAELKHAGWDAIYIEGKAEKPVY
ILIQDDNVEIKDASHLWGKVVSETEATLRQEIGSEKAKIALIGPAGENLVKIAAVMNDGH
RAAGRAGVGAVMGSKNLKAIAVIGSKGAPQPADREKFMQVVREKVNILRNDPVAGGGLPK
YGTAVLVNIINENGLYPHKNFQTGVYDKAPEQSGEALEAKYLTKNKPCYACPIGCGRVTK
LPLMKEESEGPEYESIWTFGSNMGINDLASIVTANHLCDEYGLDTISTGSTLAAAMELYE
NGLIKDEEFEPGPPFRFGNTEVLHYYIDKIAKREGFGDKLAEGSYRLAESYGRPEFSMSV
KKLELPAYDPRVVQGLGLHYATCNRGGDHVKGYMISPEILGYPKKMDPTDTSEEKVAMTK
LIQEATALVDSAGLCIFTSFGLWGDDYRDLLNSFFGWDLSTEEYIKIGERIWNAERIFNL
EAGLKAEEDTLPPRMINEPMPEGPYKGQTSRVKEMMPVYYKLRGWNPDGTVSDAKKQELG
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgagatcaagttgttaaaggttaatctcacagagaagaaagtggagacggag
gtcttaggtgaggacatcgccaaaaggtggataggaggaagagggcttggagcttacctt
atgctcagggcgaaagcctccaaagtagatcctctcggtcctgaaaatcccttgatattt
gcccccgggcccttgagcggcacaagtgccccgacgggaggccgttacaacgtagtcaca
aaaagccccacaaccgggtttatagccttcgccaactctggaggttatttcggtgcggag
ctgaagcatgcaggttgggatgccatctacattgaaggtaaggcggaaaaacctgtatat
attctgattcaggacgacaatgtggagataaaggatgcgtcccacctctggggtaaggtt
gtaagtgaaaccgaggcaaccttgaggcaagagatcggaagcgaaaaagcaaaaattgct
ttgatagggccggccggcgaaaaccttgtaaagattgctgctgtcatgaacgatggacac
agagctgcagggcgtgccggcgttggtgccgtcatgggcagcaaaaacttgaaagccata
gcagtgattggttcaaagggagcacctcaacctgcggacagagaaaagtttatgcaggtc
gttagggaaaaggtgaacatcctgcgaaacgaccccgttgcagggggcggcttgcccaag
tacggtacggctgtgctggtcaatataatcaacgaaaacgggctatatccccacaagaac
ttccagaccggtgtttacgacaaggcgccagaacagagcggagaggctctagaagccaag
tatctcaccaagaacaaaccttgctatgcctgccccataggctgtggcagggtcactaag
ctacctctcatgaaggaagagtcagaaggaccagagtacgagagtatttggacctttgga
tccaatatgggcatcaatgaccttgcgtccatagtgacggcaaaccacctgtgcgacgaa
tacggcttggataccatatccacgggctcaactctggcggcggccatggaactctacgag
aacggcctgataaaggatgaggaattcgagccaggcccgccctttaggtttggcaacaca
gaggtactgcactactacatagacaagatcgcaaagagagagggttttggtgacaagctc
gccgagggaagctacaggttggccgagtcttacggcaggccggaattttccatgagcgta
aagaagcttgagcttcctgcgtatgacccgagggtagtccaaggcctaggactccactat
gctacgtgcaacaggggaggagaccacgtaaaaggttacatgataagccctgagattctt
gggtatcccaagaaaatggacccaacggacaccagtgaggaaaaggtagccatgaccaag
ctgattcaagaggccacggccttggtggattctgcagggctttgcatctttacgtccttt
ggcttatggggagacgactatagggatctgctcaacagcttctttggttgggacctctct
acggaagagtacataaagataggcgagcgtatatggaatgcggagaggattttcaacctt
gaagctggcctaaaggcggaggaggataccttgcctccgaggatgataaatgaaccaatg
cctgaagggccttacaaagggcaaacttccagagtcaaggaaatgatgccggtgtactac
aaactcagaggatggaaccccgacggcacggtctccgatgccaagaagcaggagctgggc
ctgtag

DBGET integrated database retrieval system