KEGG   Thermococcus litoralis: OCC_00135Help
Entry
OCC_00135         CDS       T02800                                 

Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
tlt  Thermococcus litoralis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tlt00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    OCC_00135
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OCC_00135
   00330 Arginine and proline metabolism
    OCC_00135
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    OCC_00135
Enzymes [BR:tlt01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     OCC_00135
Exosome [BR:tlt04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   OCC_00135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2188035..2189294)
Genome map
AA seq 419 aa AA seqDB search
MVEQDPFEIAVKQLERAAQYMDISEEALEFLKRPQRIVEVSIPVEMDDGSVKVFTGFRVQ
YNWARGPTKGGIRWHPEETLSTVKALAAWMTWKTAVMDLPYGGGKGGVICNPKEMSDREK
ERLARGYVRAIYDVISPYTDIPAPDVYTNPQIMAWMMDEYETISRRKDPSFGVITGKPPS
VGGIVARMDATARGASYTVREAAKALGMDLKGKTIAIQGYGNAGYYMAKIMSEEYGMKVV
AVSDSKGGIYNPDGLNADEVLAWKKKTGSVKDFPGATNITNEELLELEVDVLAPSAIEEV
ITKKNADNIKAKIVAELANGPTTPEADEILYEKGILIIPDFLCNAGGVTVSYFEWVQNIT
GDYWTVEETRAKLDKKMTKAFWDVYNTHKEKNINMRDAAYVVAVSRVYQAMKDRGWIKK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggttgagcaagacccatttgaaattgctgttaagcagcttgaaagagctgcccaatat
atggacataagtgaagaggcccttgagtttttaaagaggccacaaagaattgttgaagtc
agcattccagttgagatggatgacggttctgtaaaggttttcacaggatttagagtccaa
tacaactgggctcgcggtccaacaaagggtggtattagatggcaccctgaagaaacactt
agcaccgtcaaggctttggccgcttggatgacctggaagactgccgttatggacctccca
tatggtggaggtaagggtggtgtcatctgtaatccaaaggaaatgagcgacagagagaag
gaaagacttgctagaggatatgtaagagctatctatgatgttataagcccatacaccgat
attccagctccagacgtttacactaacccacagatcatggcatggatgatggacgaatat
gaaacaatctcaagaaggaaagacccatcctttggtgttatcacgggtaaaccaccaagc
gttggtggtatcgtagcaagaatggatgccacagctagaggtgcaagctacacagttagg
gaagccgcaaaggctcttggaatggacttgaagggcaagacaatagccatccagggttac
ggtaacgctggatactacatggccaagatcatgagcgaagagtacggaatgaaggttgtt
gcagtcagcgacagcaagggtggtatatacaacccagatggcctcaacgctgacgaagtt
cttgcttggaagaagaagaccggtagcgttaaggacttcccaggagcaaccaacataacc
aacgaagagctccttgagcttgaggtagatgttcttgcaccatcagctatcgaagaggtc
atcacaaagaagaacgccgacaacatcaaggccaagatcgttgccgagcttgcaaacggt
ccaaccacaccagaggcagacgagattctctacgagaagggcatactcatcatccccgac
ttcctctgtaacgcaggtggtgttacagtaagctacttcgaatgggtacagaacataacc
ggtgattactggacagttgaggagacaagggcaaagcttgacaagaagatgaccaaggcc
ttctgggacgtttacaacacccacaaggagaagaacatcaacatgagagacgctgcttac
gtagttgcagtcagcagagtctaccaagcaatgaaagaccgcggatggatcaagaagtga

DBGET integrated database retrieval system