KEGG   Thermococcus litoralis: OCC_01064Help
Entry
OCC_01064         CDS       T02800                                 

Definition
peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tlt  Thermococcus litoralis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tlt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(79427..80473)
Genome map
AA seq 348 aa AA seqDB search
MVDYELLKRIVEAPGVTGYEFMGVRDVVIEALKDYVDEIKVDKLGNIIAHKKGDGPKVMI
AGHMDQIGLMVTHIEKNGFLRVAPVGGIDPRTLIAQRFKVWIDKGKFIYGVGGSVPPHIQ
KPEDRKKAPEWDQIFIDIGAESKEEAEEMGVKIGTVITWDGRLERLGKHRFVSIAFDDRI
AVYTLVETARQLKESNADIYFVATVQEEVGLRGAKTSAFGIDPDYGFAIDVTIAADVPGT
PEHKQVTQLGKGTAIKIMDRSVICHPKIVRWMEELAKKYEIPYQWDILLGGGTDAGAIHL
NKAGVPTGAISIPSRYIHSNAEVVDERDVDASVKLMVKILEHIHELEI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggactatgaactgttaaagaggatagtcgaagctcctggagttaccggctatgag
ttcatgggagttagagacgttgttattgaagcgctaaaggattacgttgatgagatcaaa
gtcgacaagctcggaaacattattgcccacaagaaaggcgatggtccaaaggttatgatt
gctggacatatggatcaaataggtcttatggtaacgcacattgagaagaacgggtttttg
agagttgccccagtaggaggaattgatccgagaactttgattgcccaacgcttcaaggtc
tggattgacaagggcaagttcatctacggagttggtgggagtgttcctccacacattcaa
aaacctgaggataggaaaaaagcccccgagtgggatcaaattttcattgacataggggct
gagtcaaaggaagaagccgaagagatgggcgtcaaaatcggaaccgtgattacatgggac
ggaaggctcgagaggctcggcaagcaccgctttgttagcattgcatttgacgacagaata
gccgtttatactctagttgagactgcaaggcaacttaaggagtcaaacgccgacatatac
tttgtggcaacagttcaggaagaagtggggcttagaggagcgaagacaagtgcctttggc
attgatccggactatgggtttgcaatagacgttacaatagcggctgacgttccgggcact
ccggagcacaagcaagttactcagctcggcaagggaacggcaataaagataatggatcgc
tcagtcatatgccatccaaagatagttagatggatggaagagctcgcaaagaagtacgag
ataccctaccagtgggacatcctcctcggcggaggaaccgatgctggtgcaatacacctc
aacaaggcgggcgttccaactggggcaataagcattccctcaagatacatccactcgaac
gctgaagtcgttgatgagagggacgtagatgcaagcgttaagctcatggtaaagatcctt
gagcacatacacgagcttgagatttga

DBGET integrated database retrieval system