KEGG   Thermococcus litoralis: OCC_02747Help
Entry
OCC_02747         CDS       T02800                                 

Definition
(RefSeq) thymidine phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
tlt  Thermococcus litoralis
Brite
Enzymes [BR:tlt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     OCC_02747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(195391..196902)
Genome map
AA seq 503 aa AA seqDB search
MRAKVKILDVETGRFMVVINEEDAKKAKLHPEDLIKIETAKRTIYGDVVISNMVQPGEIG
VTKDIMRAYSFSEGEMVNVVPAGTPESVRYVKKKMNGQKLKKVEIEAIVKDIVDRKLRDI
EISSFVTSLEINGLDMDEIAWLTMAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNVLVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLAPVTFSLDEIKRIVEKIGACLVWGGALNLA
PADDLTIKAERALSIDPRGLMLASIMSKKYAMGSQYVLIDIPTGEGVKVETIEEARSLAK
DFIELGKRLGQYVETAITYGGQPIGHTVGPALEAKEALETIMTGKGPGSLVEKATGLAGI
LLEMGGVAPAGMGKKMAKEILESGKAYEKLKEIIAEQGGDPNIKPEDIPIGDKTYTFVAQ
TSGYVTKIDNKAITTIARAAGAPEDKGAGILLHVKVGEKVREGDPLFTIHAESEVRLDQA
IIQARRMEPIRIEGMVLQRIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgaaagtgaagattttggatgtagagaccgggagatttatggtagtaatcaac
gaggaagacgctaagaaagcaaagcttcatccagaggacctaattaaaatagaaaccgca
aaaagaacaatatacggagatgtggttataagcaacatggttcagccgggggagataggg
gttacaaaggacataatgcgtgcttattccttttctgaaggagaaatggtaaacgtagtt
cctgcaggaactccagaaagcgtgagatatgttaagaaaaagatgaatggtcaaaagctt
aagaaggttgaaatagaggcaattgttaaagacatcgtcgatagaaaacttcgggacata
gaaataagttcttttgtaacttctcttgagataaacggacttgatatggatgagattgcg
tggcttacaatggcaatggcagagactggagatatgttggatatagatagaaagccgatt
atggatgttcacagcataggtggagttcccggaaacaagacaaatgtgcttgtagtgccg
atagttgccgcagccggcttaacaatcccaaagacctcttcaagggcaataacaagtgcc
gctggaactgctgatgtggtagaagttcttgctccagtgactttctcattggacgaaata
aagaggattgtagaaaaaattggcgcctgtttggtgtggggtggagcccttaacttggcc
cccgctgatgacctaacaattaaagccgaaagggcattaagcattgatcctagggggctt
atgcttgcgagcataatgtcgaagaagtacgccatgggttctcaatacgttctcatagac
ataccaacgggagagggagtgaaggttgagaccatagaggaggcaaggtctctggcaaaa
gacttcatagagctgggaaagagactcggtcaatatgtggaaacagcgattacttatggg
ggccagccaataggacacacagttggccctgcgcttgaggctaaagaagctttagagacc
ataatgacaggcaaaggtccggggagtctggtcgagaaggccacaggcttagcggggatt
ctgcttgagatgggcggagtagcaccggcaggaatgggaaagaagatggcgaaagaaatc
ctcgagagcggaaaagcttacgaaaagttaaaggagataatagccgagcagggcggagat
ccaaatataaagccagaagatatcccaataggcgacaaaacttacaccttcgtagctcaa
acctctggatatgtaacaaagattgataacaaagcgataacgacaatagcaagagccgct
ggggctccggaagacaaaggtgccggaattctgctccacgtcaaagttggagaaaaagtt
agggaaggggatcccctctttacaatacacgcagagagcgaagttagactcgaccaagca
ataattcaagcaaggagaatggagccgataagaatagagggcatggtgctccagagaatt
ggaaatatctaa

DBGET integrated database retrieval system