KEGG   Thermococcus litoralis: OCC_02747Help
Entry
OCC_02747         CDS       T02800                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tlt  Thermococcus litoralis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tlt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OCC_02747
Enzymes [BR:tlt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     OCC_02747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(195391..196902)
Genome map
AA seq 503 aa AA seqDB search
MRAKVKILDVETGRFMVVINEEDAKKAKLHPEDLIKIETAKRTIYGDVVISNMVQPGEIG
VTKDIMRAYSFSEGEMVNVVPAGTPESVRYVKKKMNGQKLKKVEIEAIVKDIVDRKLRDI
EISSFVTSLEINGLDMDEIAWLTMAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNVLVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLAPVTFSLDEIKRIVEKIGACLVWGGALNLA
PADDLTIKAERALSIDPRGLMLASIMSKKYAMGSQYVLIDIPTGEGVKVETIEEARSLAK
DFIELGKRLGQYVETAITYGGQPIGHTVGPALEAKEALETIMTGKGPGSLVEKATGLAGI
LLEMGGVAPAGMGKKMAKEILESGKAYEKLKEIIAEQGGDPNIKPEDIPIGDKTYTFVAQ
TSGYVTKIDNKAITTIARAAGAPEDKGAGILLHVKVGEKVREGDPLFTIHAESEVRLDQA
IIQARRMEPIRIEGMVLQRIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgaaagtgaagattttggatgtagagaccgggagatttatggtagtaatcaac
gaggaagacgctaagaaagcaaagcttcatccagaggacctaattaaaatagaaaccgca
aaaagaacaatatacggagatgtggttataagcaacatggttcagccgggggagataggg
gttacaaaggacataatgcgtgcttattccttttctgaaggagaaatggtaaacgtagtt
cctgcaggaactccagaaagcgtgagatatgttaagaaaaagatgaatggtcaaaagctt
aagaaggttgaaatagaggcaattgttaaagacatcgtcgatagaaaacttcgggacata
gaaataagttcttttgtaacttctcttgagataaacggacttgatatggatgagattgcg
tggcttacaatggcaatggcagagactggagatatgttggatatagatagaaagccgatt
atggatgttcacagcataggtggagttcccggaaacaagacaaatgtgcttgtagtgccg
atagttgccgcagccggcttaacaatcccaaagacctcttcaagggcaataacaagtgcc
gctggaactgctgatgtggtagaagttcttgctccagtgactttctcattggacgaaata
aagaggattgtagaaaaaattggcgcctgtttggtgtggggtggagcccttaacttggcc
cccgctgatgacctaacaattaaagccgaaagggcattaagcattgatcctagggggctt
atgcttgcgagcataatgtcgaagaagtacgccatgggttctcaatacgttctcatagac
ataccaacgggagagggagtgaaggttgagaccatagaggaggcaaggtctctggcaaaa
gacttcatagagctgggaaagagactcggtcaatatgtggaaacagcgattacttatggg
ggccagccaataggacacacagttggccctgcgcttgaggctaaagaagctttagagacc
ataatgacaggcaaaggtccggggagtctggtcgagaaggccacaggcttagcggggatt
ctgcttgagatgggcggagtagcaccggcaggaatgggaaagaagatggcgaaagaaatc
ctcgagagcggaaaagcttacgaaaagttaaaggagataatagccgagcagggcggagat
ccaaatataaagccagaagatatcccaataggcgacaaaacttacaccttcgtagctcaa
acctctggatatgtaacaaagattgataacaaagcgataacgacaatagcaagagccgct
ggggctccggaagacaaaggtgccggaattctgctccacgtcaaagttggagaaaaagtt
agggaaggggatcccctctttacaatacacgcagagagcgaagttagactcgaccaagca
ataattcaagcaaggagaatggagccgataagaatagagggcatggtgctccagagaatt
ggaaatatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system