KEGG   Thermococcus litoralis: OCC_03462Help
Entry
OCC_03462         CDS       T02800                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
tlt  Thermococcus litoralis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tlt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    OCC_03462
Enzymes [BR:tlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     OCC_03462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1469940..1470518)
Genome map
AA seq 192 aa AA seqDB search
MHPEGFLEVITGPMFAGKTSELIKRIERQIFAKRKAALFKPSIDNRYSEDKVVAHNGLSY
EAFVVPTTEEGVRTIYQKTKEEDFEVIGIDEVQFFPMSIVEILNKLADEGVYVIASGLNL
DFKGEPFEVTKELLALADNIVYLTAICSVCGREATRTQRLINGKPAPRDSPRILVGGIEA
YEARCRRHHIVP
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcatccagaggggttcttggaggtcattaccggaccaatgttcgcaggaaagacaagt
gaactgataaaaaggatagaaaggcagatttttgcgaaaagaaaggcggctcttttcaaa
ccgtcaatagacaaccgctacagcgaagataaagtagttgctcacaacggattaagctat
gaagccttcgtagtgcctacaacagaggaaggtgtgaggactatataccaaaaaaccaag
gaggaggattttgaagttataggcatcgatgaggtccagttctttccgatgtcgatcgtt
gaaatcctaaacaagctcgccgatgaaggcgtttacgttatagccagcggtctgaattta
gattttaagggagaaccctttgaagtaaccaaggaattattagcgctagcagacaacatt
gtctatctaacggccatatgcagcgtctgcggaagggaagccacaaggacgcagaggctc
ataaatggaaaacccgccccaagagactcccccaggatacttgtgggtggaatagaagct
tatgaagcccggtgcaggagacaccacatagtgccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system