KEGG   Thermococcus litoralis: OCC_11682Help
Entry
OCC_11682         CDS       T02800                                 

Definition
(GenBank) peptidase M42
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
tlt  Thermococcus litoralis
Brite
Enzymes [BR:tlt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     OCC_11682
Peptidases [BR:tlt01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   OCC_11682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1493134..1494171)
Genome map
AA seq 345 aa AA seqDB search
MVNWELMQKVIEAPGVSGYEFMGIRDVVIEALEDYVDEIKVDKLGNVIAHKKGDSPKVMI
AAHMDKIGLMVNHIDEKGYLHVVPVGGVDPRTLVAQRVRIFGEKGEIYGVVGHVPPHLTK
PEERNKAADWDTIVIDIGADSKEEAEKMGVKVGTIMEFAPAFTRLNENRFATPYLDDRIC
LYAMIEAARALEGHQADIYFVASVQEEVGLRGARVASYAIDPEIGIAMDVTFAKQPGDKG
KIVPELGKGPVMDVGPNINPKIRAFADEVAKKYEIPLQVEPSPRPTGTDANIMQINREGV
ATAVLSIPIKYMHSQVELADARDVDNTIKLAKHLLEELKPMDLTP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttaactgggagcttatgcagaaggttatcgaagctccaggggtttctggatacgag
ttcatgggaatcagggatgttgtaatcgaagctcttgaagattacgtcgatgaaatcaaa
gtggacaagcttggaaacgtcatagcccacaagaagggcgatagtccaaaggtgatgatc
gctgcccacatggacaaaataggtcttatggtgaaccatatagacgaaaagggctaccta
cacgttgttccagttggtggggttgatccaagaactcttgtggcacaaagggtaagaatc
ttcggggaaaagggagaaatatacggtgtcgtcggacatgttccgccccacctaaccaag
ccagaagagagaaacaaagctgccgattgggatacaatagtcatcgacatcggagcagac
tccaaggaagaagcggagaaaatgggcgtaaaggtaggaaccataatggaatttgcccct
gctttcacaaggcttaacgaaaaccgctttgcaaccccatatttagacgatagaatctgc
ctatatgcaatgatagaagcggcaagagcattggaaggacatcaagcagacatatacttc
gtggcaagcgtccaagaagaggttggactgagaggtgctagggtggcaagctatgcaatt
gacccagagattggaatagcgatggacgttacctttgccaaacagccaggggacaaagga
aaaatagtcccagagctcggaaaaggccccgtaatggacgttggaccaaacataaatcca
aagataagggcatttgctgatgaagttgccaagaaatacgagatacccctccaagtagag
ccaagcccaagaccaaccggaactgatgcaaacatcatgcagataaaccgtgaaggagta
gcgacagcagtcctttcgattccaataaaatatatgcactcacaggtagagcttgccgat
gcgagagacgttgataataccataaaacttgcaaaacatctgctggaagagctcaaacca
atggacttaactccatga

DBGET integrated database retrieval system