KEGG   Thermococcus litoralis: OCC_11682Help
Entry
OCC_11682         CDS       T02800                                 

Definition
peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tlt  Thermococcus litoralis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tlt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCC_11682
Enzymes [BR:tlt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     OCC_11682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1493134..1494171)
Genome map
AA seq 345 aa AA seqDB search
MVNWELMQKVIEAPGVSGYEFMGIRDVVIEALEDYVDEIKVDKLGNVIAHKKGDSPKVMI
AAHMDKIGLMVNHIDEKGYLHVVPVGGVDPRTLVAQRVRIFGEKGEIYGVVGHVPPHLTK
PEERNKAADWDTIVIDIGADSKEEAEKMGVKVGTIMEFAPAFTRLNENRFATPYLDDRIC
LYAMIEAARALEGHQADIYFVASVQEEVGLRGARVASYAIDPEIGIAMDVTFAKQPGDKG
KIVPELGKGPVMDVGPNINPKIRAFADEVAKKYEIPLQVEPSPRPTGTDANIMQINREGV
ATAVLSIPIKYMHSQVELADARDVDNTIKLAKHLLEELKPMDLTP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttaactgggagcttatgcagaaggttatcgaagctccaggggtttctggatacgag
ttcatgggaatcagggatgttgtaatcgaagctcttgaagattacgtcgatgaaatcaaa
gtggacaagcttggaaacgtcatagcccacaagaagggcgatagtccaaaggtgatgatc
gctgcccacatggacaaaataggtcttatggtgaaccatatagacgaaaagggctaccta
cacgttgttccagttggtggggttgatccaagaactcttgtggcacaaagggtaagaatc
ttcggggaaaagggagaaatatacggtgtcgtcggacatgttccgccccacctaaccaag
ccagaagagagaaacaaagctgccgattgggatacaatagtcatcgacatcggagcagac
tccaaggaagaagcggagaaaatgggcgtaaaggtaggaaccataatggaatttgcccct
gctttcacaaggcttaacgaaaaccgctttgcaaccccatatttagacgatagaatctgc
ctatatgcaatgatagaagcggcaagagcattggaaggacatcaagcagacatatacttc
gtggcaagcgtccaagaagaggttggactgagaggtgctagggtggcaagctatgcaatt
gacccagagattggaatagcgatggacgttacctttgccaaacagccaggggacaaagga
aaaatagtcccagagctcggaaaaggccccgtaatggacgttggaccaaacataaatcca
aagataagggcatttgctgatgaagttgccaagaaatacgagatacccctccaagtagag
ccaagcccaagaccaaccggaactgatgcaaacatcatgcagataaaccgtgaaggagta
gcgacagcagtcctttcgattccaataaaatatatgcactcacaggtagagcttgccgat
gcgagagacgttgataataccataaaacttgcaaaacatctgctggaagagctcaaacca
atggacttaactccatga

DBGET integrated database retrieval system