KEGG   Thermotoga maritima MSB8: TM0015Help
Entry
TM0015            CDS       T00022                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00010  Glycolysis / Gluconeogenesis
tma00020  Citrate cycle (TCA cycle)
tma00620  Pyruvate metabolism
tma00633  Nitrotoluene degradation
tma00640  Propanoate metabolism
tma00650  Butanoate metabolism
tma00680  Methane metabolism
tma01100  Metabolic pathways
tma01120  Microbial metabolism in diverse environments
tma01130  Biosynthesis of antibiotics
tma01200  Carbon metabolism
Module
tma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0015
   00020 Citrate cycle (TCA cycle)
    TM0015
   00620 Pyruvate metabolism
    TM0015
   00640 Propanoate metabolism
    TM0015
   00650 Butanoate metabolism
    TM0015
  Energy metabolism
   00680 Methane metabolism
    TM0015
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TM0015
Enzymes [BR:tma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TM0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-GeneID: 896829
NCBI-ProteinID: NP_227831
UniProt: O05650 G4FGT1
Structure
PDB: 

Jmol
Position
13245..13823
Genome map
AA seq 192 aa AA seqDB search
MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIG
DEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKIC
VVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRA
LRRGYEEVKCSE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttgcgaagaaatactttgaaatacgatggcacggtagagccgggcaaggtgcg
aagagtgcttcccagatgctggcagaagccgctctggaagccgggaaatacgttcaggct
tttccagaatacggtgcagaaagaacaggtgctcccatgagggccttcaacaggattggt
gacgagtacatcagagtgagatctgcagtggaaaacccggacgtcgttgtggtgatcgat
gaaacactactttctcccgccattgtagaaggcctttcagaagatggtatcctccttgtg
aacaccgttaaggatttcgaattcgtcagaaaaaagacaggattcaacggaaagatatgc
gtggtggatgctacagacatcgctctccaggagataaagagaggaataccgaacacaccg
atgcttggagcgctggtcagagtgacaggtattgtgcctctcgaggcgatagagaagaga
atcgagaagatgttcggaaagaaattccctcaggaagtgattgatgcgaacaagagagct
ttgagacgtggatatgaggaagtaaagtgctcagagtga

DBGET integrated database retrieval system