KEGG   Thermotoga maritima: TM0016Help
Entry
TM0016            CDS       T00022                                 

Definition
pyruvate ferredoxin oxidoreductase, delta subunit
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tma  Thermotoga maritima
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM0016
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0016
   00020 Citrate cycle (TCA cycle)
    TM0016
   00620 Pyruvate metabolism
    TM0016
   00640 Propanoate metabolism
    TM0016
   00650 Butanoate metabolism
    TM0016
  Energy metabolism
   00680 Methane metabolism
    TM0016
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TM0016
Enzymes [BR:tma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TM0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
13830..14135
Genome map
AA seq 101 aa AA seqDB search
MRMSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQ
EGGIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEG
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatgtctcttaaaagctggaaggaaattcccattggaggagtcatcgacaaaccg
ggaacagcaagagaatacaaaacaggtgcctggcgtgtgatgagacctattcttcacaaa
gagaaatgtatagactgtatgttctgctggctctactgtccagatcaagcgatcatccaa
gaaggcggaataatgaaaggtttcaactacgactactgtaaaggatgcggactctgtgcg
aacgtatgtccaaagcaggccatagagatgagacctgagactgagtttctgagcgaggag
ggatga

DBGET integrated database retrieval system