KEGG   Thermotoga maritima: TM0017Help
Entry
TM0017            CDS       T00022                                 

Definition
pyruvate ferredoxin oxidoreductase, alpha subunit
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
tma  Thermotoga maritima
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM0017
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0017
   00020 Citrate cycle (TCA cycle)
    TM0017
   00620 Pyruvate metabolism
    TM0017
   00640 Propanoate metabolism
    TM0017
   00650 Butanoate metabolism
    TM0017
  Energy metabolism
   00680 Methane metabolism
    TM0017
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TM0017
Enzymes [BR:tma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TM0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14132..15316
Genome map
AA seq 394 aa AA seqDB search
MRMERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIP
VESEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPI
NIHCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHG
VEPVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKV
FPEIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKI
WMFRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGL
GGRDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggaaagggtcgtcgagagagtggccgtcaccggcgctgaggccgttgccaat
gcgatgagacagatagagcccgatgtcgttgcggcgtacccgatcactccacagacacct
attgtggagtacttcgccaggttcgtcgcggacggcgttgtcaggacagaaatgattccc
gtcgaaagtgaacacagtgcgatgagcgctgtcgttggagccgctgccgcgggagcaaga
gcgatgacagcaaccagtgcaaatggactcgcactgatgcacgaaatagtttacatcgct
gcctcctacagacttcccattgtgatgcccgttgtgaacagagcgctcagtggtcctata
aacattcactgtgaccacagcgacgcgatggcagaaagggattctggatggattcagctc
tttgcggaaactaatcaggaggcttacgatttcaccattctcgctgtgagactggcagaa
cacgaagatgtgagacttcccgtcatggtgaacctcgatgggttcatcctttctcacgga
gtggaacccgttgagttctatcccgatgaactcgtgaagaagttcgttggagagctcaaa
cccatgtatcctcttctggatactgaacaccctgtaacctggggtcctctcgatctttac
gattactacttcgaacacaaaagacagcagattgaagccatggaaaacgtaaagaaggtg
ttcccggaaatcgcaaaagaattcgaagaaacgtttggaaggaaatactggtttgtcgaa
ccgtacagaatggaagatgcagagcacgtgatggtagcactgggctccacaaacagcacg
ataaagtacgtggttgatgaactgagagaagaaggctacaaagttggatctttgaaaatc
tggatgttcagaccgttcccgaaggagcagcttcaggaactcctcaacggaagaaagagt
gtagttgtgctcgacagagctgtttccttcggagcggaagcacctctctacgaagcagtg
aaatctgcgctctacgaagtagcagcgaggccgatgcttggatcctatgtctacggtctc
ggtggaagggacatcaaaccagagcacatcagaaaagcgttcgaagatgccataaacgga
aacctcatagcagatgaacagagatatcttggtctcagagagtga

DBGET integrated database retrieval system