KEGG   Thermotoga maritima MSB8: TM0017Help
Entry
TM0017            CDS       T00022                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00010  Glycolysis / Gluconeogenesis
tma00020  Citrate cycle (TCA cycle)
tma00620  Pyruvate metabolism
tma00633  Nitrotoluene degradation
tma00640  Propanoate metabolism
tma00650  Butanoate metabolism
tma00680  Methane metabolism
tma01100  Metabolic pathways
tma01120  Microbial metabolism in diverse environments
tma01130  Biosynthesis of antibiotics
tma01200  Carbon metabolism
Module
tma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0017
   00020 Citrate cycle (TCA cycle)
    TM0017
   00620 Pyruvate metabolism
    TM0017
   00640 Propanoate metabolism
    TM0017
   00650 Butanoate metabolism
    TM0017
  Energy metabolism
   00680 Methane metabolism
    TM0017
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TM0017
Enzymes [BR:tma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TM0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C Glycogen_syn
Motif
Other DBs
NCBI-GeneID: 896831
NCBI-ProteinID: NP_227833
UniProt: O05651
Position
14132..15316
Genome map
AA seq 394 aa AA seqDB search
MRMERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIP
VESEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPI
NIHCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHG
VEPVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKV
FPEIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKI
WMFRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGL
GGRDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggaaagggtcgtcgagagagtggccgtcaccggcgctgaggccgttgccaat
gcgatgagacagatagagcccgatgtcgttgcggcgtacccgatcactccacagacacct
attgtggagtacttcgccaggttcgtcgcggacggcgttgtcaggacagaaatgattccc
gtcgaaagtgaacacagtgcgatgagcgctgtcgttggagccgctgccgcgggagcaaga
gcgatgacagcaaccagtgcaaatggactcgcactgatgcacgaaatagtttacatcgct
gcctcctacagacttcccattgtgatgcccgttgtgaacagagcgctcagtggtcctata
aacattcactgtgaccacagcgacgcgatggcagaaagggattctggatggattcagctc
tttgcggaaactaatcaggaggcttacgatttcaccattctcgctgtgagactggcagaa
cacgaagatgtgagacttcccgtcatggtgaacctcgatgggttcatcctttctcacgga
gtggaacccgttgagttctatcccgatgaactcgtgaagaagttcgttggagagctcaaa
cccatgtatcctcttctggatactgaacaccctgtaacctggggtcctctcgatctttac
gattactacttcgaacacaaaagacagcagattgaagccatggaaaacgtaaagaaggtg
ttcccggaaatcgcaaaagaattcgaagaaacgtttggaaggaaatactggtttgtcgaa
ccgtacagaatggaagatgcagagcacgtgatggtagcactgggctccacaaacagcacg
ataaagtacgtggttgatgaactgagagaagaaggctacaaagttggatctttgaaaatc
tggatgttcagaccgttcccgaaggagcagcttcaggaactcctcaacggaagaaagagt
gtagttgtgctcgacagagctgtttccttcggagcggaagcacctctctacgaagcagtg
aaatctgcgctctacgaagtagcagcgaggccgatgcttggatcctatgtctacggtctc
ggtggaagggacatcaaaccagagcacatcagaaaagcgttcgaagatgccataaacgga
aacctcatagcagatgaacagagatatcttggtctcagagagtga

DBGET integrated database retrieval system