KEGG   Thermotoga maritima: TM0018Help
Entry
TM0018            CDS       T00022                                 

Definition
pyruvate ferredoxin oxidoreductase, beta subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tma  Thermotoga maritima
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM0018
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0018
   00020 Citrate cycle (TCA cycle)
    TM0018
   00620 Pyruvate metabolism
    TM0018
   00640 Propanoate metabolism
    TM0018
   00650 Butanoate metabolism
    TM0018
  Energy metabolism
   00680 Methane metabolism
    TM0018
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TM0018
Enzymes [BR:tma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TM0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
15331..16305
Genome map
AA seq 324 aa AA seqDB search
MPVNIKQLAQEFDKKEIGITQGHRLCPGCGAPITVKFVMMIARHLGYEPVVGLATGCLEV
STSIYPYTAWSVPYIHNAFENVAATMSGVETAYKALKNKGKIPEDKKYAFIAFGGDGGTY
DIGLQSLSGMLERGHKVLYVLYDNEGYMNTGNQRSGSTPPGSDTTTAPVGKKLPGKVQLK
KNIVEIVAAHENVYAATASLSEPMDFFAKVEKALNFDGPSFLAVFSPCVRFWRVNDDKTV
EISKLAVETKYWPLYEVERGVYRVTRKPRQFKPVEEFLKAQGRFRKLLSRPDAKEIVDEL
QEYVDRRWERLLTLEEVTKDKPIR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcccgttaacataaaacagctggcacaggagttcgataagaaagaaatcggtatcaca
cagggtcacaggctctgtccaggttgtggagcacccatcacagtgaagttcgtgatgatg
atcgcaagacacctcggatacgaacccgttgttggactcgcaacaggttgtctggaggtt
tctacctccatctatccgtacaccgcttggagcgtaccttacattcacaacgcctttgaa
aacgtggcagcaacgatgagcggtgtggaaacggcttacaaagcactgaaaaacaaagga
aagatcccagaagacaaaaaatacgccttcattgcttttggtggagacggtggaacgtac
gatatcggtcttcagtcactgtccgggatgctcgaaagaggtcacaaggtgctctacgtc
ctctacgacaacgagggatacatgaacacaggaaaccagagatccggatccacacccccg
ggttcggataccacgacagctccagttggaaagaagctccctggaaaggtccagctgaaa
aagaacatcgtcgagatcgtagcggctcacgagaacgtctacgcagctaccgcatcgctc
tctgaacccatggacttctttgccaaggtggaaaaggcgctgaacttcgatggaccttct
ttccttgcggtcttctctccttgcgtcaggttctggagagtgaacgacgataaaacagta
gaaatatcaaaactcgccgtagaaacgaagtactggcctttgtacgaagtggaaagagga
gtttacagagtcaccagaaaaccgagacagttcaaacctgtggaggaattcctgaaggct
cagggaaggttcagaaaacttctttcaagaccggatgcaaaagaaatcgtagacgaactc
caggaatacgtcgacagaagatgggaaagactactcacactggaagaggttacaaaggac
aaaccgattagataa

DBGET integrated database retrieval system