KEGG   Thermotoga maritima: TM0041Help
Entry
TM0041            CDS       T00022                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tma  Thermotoga maritima
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tma00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
40539..40928
Genome map
AA seq 129 aa AA seqDB search
MNKRNIKVEKVSSVIETEPYGYEDQPRFLNAVCIAQTPLSPHELLNTLLQIERNMGRVRT
IRWGPRIIDLDIVFYEDLVLSEEDLIIPHPDAHNRTFVLEPLCEIAPDLIHPVMGKTVRE
LLEDLRRRR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagagaaatataaaggtggaaaaagtctcctccgtaatagaaacagaaccatac
ggctacgaagatcaaccgaggttcctgaacgcggtttgtatcgcacaaacaccgctttct
cctcacgaactgctgaatacacttcttcaaatagagagaaacatgggaagagtgagaacg
atacggtggggacccaggatcatcgatctcgacatcgtattctatgaagatcttgttctc
agcgaagaagacctcataataccccatcccgatgcgcacaacagaacgtttgtcctggaa
ccactgtgcgagatagctccagatttaatccatcctgtgatgggaaagacagtgagagaa
ctactggaagatctcagacgacgaagatag

DBGET integrated database retrieval system