KEGG   Thermotoga maritima: TM0041Help
Entry
TM0041            CDS       T00022                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tma  Thermotoga maritima
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TM0041
Enzymes [BR:tma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TM0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
40539..40928
Genome map
AA seq 129 aa AA seqDB search
MNKRNIKVEKVSSVIETEPYGYEDQPRFLNAVCIAQTPLSPHELLNTLLQIERNMGRVRT
IRWGPRIIDLDIVFYEDLVLSEEDLIIPHPDAHNRTFVLEPLCEIAPDLIHPVMGKTVRE
LLEDLRRRR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagagaaatataaaggtggaaaaagtctcctccgtaatagaaacagaaccatac
ggctacgaagatcaaccgaggttcctgaacgcggtttgtatcgcacaaacaccgctttct
cctcacgaactgctgaatacacttcttcaaatagagagaaacatgggaagagtgagaacg
atacggtggggacccaggatcatcgatctcgacatcgtattctatgaagatcttgttctc
agcgaagaagacctcataataccccatcccgatgcgcacaacagaacgtttgtcctggaa
ccactgtgcgagatagctccagatttaatccatcctgtgatgggaaagacagtgagagaa
ctactggaagatctcagacgacgaagatag

DBGET integrated database retrieval system