KEGG   Thermotoga maritima: TM0061Help
Entry
TM0061            CDS       T00022                                 

Definition
endo-1,4-beta-xylanase A
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tma  Thermotoga maritima
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
60144..63323
Genome map
AA seq 1059 aa AA seqDB search
MQVRKRRGLLDVSTAVLVGILAGFLGVVLAASGVLSFGKEASSKGDSSLETVLALSFEGT
TEGVVPFGKDVVLTASQDVAADGEYSLKVENRTSPWDGVEIDLTGKVKSGADYLLSFQVY
QSSDAPQLFNVVARTEDEKGERYDVILDKVVVSDHWKEILVPFSPTFEGTPAKYSLIIVA
SKNTNFNFYLDKVQVLAPKESGPKVIYETSFENGVGDWQPRGDVNIEASSEVAHSGKSSL
FISNRQKGWQGAQINLKGILKTGKTYAFEAWVYQNSGQDQTIIMTMQRKYSSDASTQYEW
IKSATVPSGQWVQLSGTYTIPAGVTVEDLTLYFESQNPTLEFYVDDVKIVDTTSAEIKIE
MEPEKEIPALKEVLKDYFKVGVALPSKVFLNPKDIELITKHFNSITAENEMKPESLLAGI
ENGKLKFRFETADKYIQFVEENGMVIRGHTLVWHNQTPDWFFKDENGNLLSKEAMTERLK
EYIHTVVGHFKGKVYAWDVVNEAVDPNQPDGLRRSTWYQIMGPDYIELAFKFAREADPDA
KLFYNDYNTFEPRKRDIIYNLVKDLKEKGLIDGIGMQCHISLATDIKQIEEAIKKFSTIP
GIEIHITELDMSVYRDSSSNYPEAPRTALIEQAHKMMQLFEIFKKYSNVITNVTFWGLKD
DYSWRATRRNDWPLIFDKDHQAKLAYWAIVAPEVLPPLPKESRISEGEAVVVGMMDDSYL
MSKPIEILDEEGNVKATIRAVWKDSTIYIYGEVQDKTKKPAEDGVAIFINPNNERTPYLQ
PDDTYAVLWTNWKTEVNREDVQVKKFVGPGFRRYSFEMSITIPGVEFKKDSYIGFDAAVI
DDGKWYSWSDTTNSQKTNTMNYGTLKLEGIMVATAKYGTPVIDGEIDEIWNTTEEIETKA
VAMGSLDKNATAKVRVLWDENYLYVLAIVKDPVLNKDNSNPWEQDSVEIFIDENNHKTGY
YEDDDAQFRVNYMNEQTFGTGGSPARFKTAVKLIEGGYIVEAAIKWKTIKPTPNTVIGFN
IQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLRLIK
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaggaagagacggggtcttctggatgtttcaaccgccgtactggtggggatt
ttagcgggttttctcggtgtcgtactggcagcatcgggtgttctgagtttcgggaaagaa
gcctcctctaagggagattcttctctcgaaacagttcttgctttgagttttgaaggaaca
acagaaggtgtggtcccatttggaaaagacgttgttctcacagcttctcaggatgtagca
gcagatggtgagtactctctaaaggtcgagaacagaacctccccatgggatggggtagaa
atcgacctgaccggaaaggtaaaatccggagcagattaccttctttccttccaggtctat
caatcttctgatgctccacagctgttcaacgtagtcgcgagaacagaagatgagaaggga
gagaggtacgacgtcatactcgacaaggttgtcgtatcagatcactggaaagagatctta
gtaccgttctcacccacgttcgaaggcacacccgcaaaatactctctcatcatcgtagcg
tctaaaaacacgaatttcaatttctaccttgacaaggttcaggtacttgctccaaaagaa
tcgggcccaaaggtcatctacgaaacatcctttgaaaacggtgttggagactggcagccc
agaggagacgtgaacatcgaagcttcatctgaagtggcacattcaggtaagagttcgctc
tttatctccaacaggcagaagggctggcagggtgcccagatcaacttgaaaggaatcctg
aaaacaggaaaaacctacgcctttgaagcctgggtctatcagaactccggtcaagatcag
acgatcatcatgacaatgcagagaaagtactcatccgacgcgagcacacagtacgaatgg
ataaaatcagccactgtaccatctggtcagtgggtgcagctttctggaacgtacacaatc
ccggccggagttaccgtggaagatctcacgctttacttcgaatctcaaaatccaactctc
gagttctacgtagacgacgtgaagatagtggatacaacttccgcagagataaagattgaa
atggaacctgaaaaagagatacctgctctgaaagaagtactaaaagactacttcaaagtc
ggagttgcactgccgtccaaggtcttcctcaacccgaaggacatagaactcatcacgaaa
cacttcaacagcatcaccgcagaaaacgagatgaaaccagagagcctgctcgcgggcatc
gaaaacggtaagctgaagttcaggtttgaaacagcagacaaatacattcagttcgtcgag
gaaaacggcatggttataagaggtcacacactggtgtggcacaaccagacacccgactgg
ttcttcaaagacgaaaacggaaacctcctctccaaagaagcgatgacggaaagactcaaa
gagtacatccacaccgttgtcggacacttcaaaggaaaagtctacgcatgggacgtggtg
aacgaagcggtcgatccgaaccagccggatggactgagaagatccacctggtaccagatc
atggggcctgactacatagaactcgccttcaagttcgcaagagaagcagatccagatgca
aaactcttctacaacgactacaacacattcgagcccagaaagagagatatcatctacaac
ctcgtgaaggatctcaaggagaagggactcatcgatgggataggcatgcagtgtcacatc
agtcttgcaacagacatcaaacagatcgaagaggccatcaaaaagttcagcaccataccc
ggtatagaaattcacatcacagaactcgatatgagtgtctacagagattccagttccaac
tacccagaggcaccgaggacggcactcatcgaacaggctcacaaaatgatgcagctcttt
gagattttcaagaagtacagcaacgtgatcacgaacgtcacattctggggtctcaaggac
gattactcctggagagcaacaagaagaaacgactggccgctcatcttcgacaaagatcac
caggcgaaactcgcttactgggcgatagtggcacctgaggtccttccaccacttccaaaa
gaaagcaggatctccgaaggcgaggctgtggtagtggggatgatggatgactcgtacctg
atgtcgaagccgatagagatccttgacgaagaagggaacgtgaaggcaacgatcagggcg
gtgtggaaagacagcacgatctacatctacggagaggtacaggacaagacgaaaaaacca
gcagaagacggagtggccatattcatcaacccgaacaacgaaagaacaccctatctgcag
cctgatgacacctacgctgtgctgtggacaaactggaagacggaggtcaacagagaagac
gtacaggtgaagaaattcgttgggcctggctttagaagatacagcttcgagatgtcgatc
acgataccgggtgtggagttcaagaaagacagctacataggattcgacgctgcggtgata
gacgacgggaagtggtacagctggagcgacacgacgaacagccagaagacgaacacgatg
aactacggaacgctgaaactcgaaggaataatggtagcgacagcaaaatacggaacaccg
gtcatcgatggagagatagacgagatctggaacacgacagaggagatagagacgaaagcg
gtggccatgggatcgcttgacaagaacgcgacagcgaaagtgagggtgctgtgggacgag
aactacctgtacgtacttgcaatcgtgaaagaccccgttctgaacaaagacaacagcaac
ccgtgggaacaggattccgtggagatcttcatcgacgagaacaaccacaagacaggatac
tacgaagacgacgacgcacagttcagggtgaactacatgaacgagcagacgtttggaacg
ggaggaagtccagcgaggttcaagacagcggtgaaactgatcgaaggaggatacatagtt
gaggcagcgatcaagtggaagacgatcaaacccacaccgaacacggtgataggattcaac
atccaggtgaacgatgcgaacgagaaagggcagagggtcggtatcatctcctggagcgat
cccacaaacaacagctggagagatccttcaaagttcggtaacctcaggctcatcaagtga

DBGET integrated database retrieval system