KEGG   Thermotoga maritima: TM0108Help
Entry
TM0108            CDS       T00022                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tma  Thermotoga maritima
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TM0108
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TM0108
Enzymes [BR:tma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     TM0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
113550..114815
Genome map
AA seq 421 aa AA seqDB search
MGKLVVQGGAVLEGEVEISGSKNAALPIMAAAILCDEEVILKNVPRLQDVFVMIDILRSI
GFRVEFEENELKIKRENDISQEVPYELVRKMRASFNVLGPIAVRTGRAKVALPGGCSIGV
RPVDFHLEGLKKMGFSIKVEHGFVEACFERRIDYVTITLPFPSVGATEHLMTTAALLKGA
RVVIENAAMEPEIVDLQNFINRMGGHIEGAGTSRIVIEGVEKMQGVEYSIIPDRIEAGTY
LVAIAASRGKGLVKNVNPDHLTNFFEKLEETGAKLKVLGNEVEIEMRERPKAVDVTTNPY
PGFPTDLQPQMMAYLSTASGVSVITENVFKTRFLHVDELKRMGADIEVSGNVAIVKGVEK
LSGAPVEGTDLRATAALLIAGIIADGVTEISNVEHIFRGYEDVIDKFSELGAKIEYVEKE
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaaactggtcgttcagggtggcgccgttctcgaaggagaagtggagatatcgggt
tcaaaaaacgctgctcttccaataatggcagcagcgattttgtgtgatgaggaggtaatt
ctcaaaaacgtaccgagactccaagatgtcttcgtcatgatagacatcctgagatccatt
ggattcagagtggaattcgaggagaacgaactgaagatcaaaagagaaaacgatatctca
caggaagtgccttacgaacttgtcaggaagatgagggcgtccttcaacgtgctcggtccg
atcgctgtgagaactggaagagcgaaggttgctcttccaggtgggtgttccataggagtc
agacctgtggactttcatcttgaaggcctcaaaaaaatgggattctcgataaaagtggaa
catggctttgttgaagcctgctttgaaagaagaatcgattatgtgacgattacccttcct
tttccaagcgttggtgccacggagcacctgatgaccacagcggctctcttaaaaggtgcc
cgtgtagtgattgaaaacgccgcaatggaacctgaaatcgtagaccttcaaaatttcata
aacagaatgggtggacatattgaaggagccggaaccagccggatagtgattgaaggcgtg
gagaaaatgcagggagttgaatacagcatcattcccgatcgaatagaagctggaacgtac
ctggtagccatcgcagcaagtcgtggaaaaggtctggtgaagaatgtaaacccggatcac
ctcacaaacttttttgagaaactggaagaaacaggggcgaaacttaaagttcttggaaac
gaagtagagatcgaaatgagagaaagaccaaaagcggtggatgttacaacgaatccgtac
cctggttttcccacggatcttcagcctcagatgatggcgtatctatcgacagcgtcggga
gtctcggttataaccgaaaacgtcttcaaaacgaggttcttacacgtggacgagttgaaa
agaatgggagcggacatagaagtttctggaaacgtcgccatagtgaaaggcgttgaaaaa
ctcagcggtgcccccgttgagggaacggatctcagggcaaccgctgcccttctcatagcg
ggaatcatagcagatggagtcactgagataagcaacgtcgaacacatattcagaggttac
gaagatgtcatagacaaattcagtgaactgggagcaaaaatcgagtatgttgaaaaagaa
aattga

DBGET integrated database retrieval system