KEGG   Thermotoga maritima: TM0111Help
Entry
TM0111            CDS       T00022                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tma  Thermotoga maritima
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TM0111
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0111
  Lipid metabolism
   00071 Fatty acid degradation
    TM0111
  Amino acid metabolism
   00350 Tyrosine metabolism
    TM0111
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TM0111
   00626 Naphthalene degradation
    TM0111
Enzymes [BR:tma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TM0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
117016..118179
Genome map
AA seq 387 aa AA seqDB search
MFKISFYLPTEIIFRVGAVDELEERAKKLGKKALIVTGRSSTKKTGLLQRVVDLLKKAGV
ESFVFDKIVPNPISDHVDEAAEIVRKEKIDFIIGLGGGSPIDSAKAISITAPNEGKFWDY
VPVGGGKIPEKSIPVVAIPTTHGTGTEADPFAVITNPQTKEKVGIGYRNTFPVLSLVDPE
VMKTLPKDQTAYTSMDAFYHAIEAFLNVNANPYSDVLALDAMKRIVTYLPVAYENGEDME
ARTNLAWASTEAGITETLTGVIANHALEHGLSGFYPEITHGLGLCITGPYLFEYIFDHAY
ERLAIVGREVFGVYETDDRKAGRLAIKKLRDFQEMFGLNKRLSELGVKKEDIPKMAETGY
RILNGVVVVTPGNLTAKDMEEIFNRCY
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaatttcgttctatcttccaacggagatcattttcagggtgggagcggtggac
gaactggaagaaagggcaaaaaagctcggaaaaaaggcattgattgtgacaggacgatcc
agcactaagaagaccggccttttgcagagggtggtagatcttctcaagaaagcgggagtg
gaaagtttcgtcttcgacaaaatagttcccaacccgatatcggatcacgtcgatgaggct
gcagaaatcgtgagaaaagagaagatagatttcatcataggacttggtggaggaagtccc
atagacagcgcaaaagcgatctctatcaccgctccgaacgaaggaaagttctgggattac
gttcccgtaggtggtggaaagattccagaaaaatccatccccgttgttgctatacccacc
acacacggaacgggaaccgaggcagacccatttgcggtgattacaaatcctcaaacgaaa
gaaaaagtgggaataggctatagaaacacctttcccgttctctcccttgtggatcctgaa
gtgatgaagacactaccgaaagaccagaccgcgtacacctctatggatgcgttctatcac
gctatagaagccttcctcaacgtgaatgcgaatccttactcggatgttcttgccctggac
gccatgaaaagaatcgtgacttaccttcccgttgcttacgagaatggagaagatatggaa
gccagaacgaatctcgcctgggccagtactgaagcaggaattacagagactctgactggt
gtgatcgcaaaccacgcgctggagcatggtctcagtggtttctatccagaaataacccat
ggtcttggtctgtgcatcacaggtccgtacctgttcgagtacatcttcgatcacgcctac
gagagactcgccatcgttggaagggaagtgtttggcgtttacgaaacagacgatagaaaa
gctggaaggctcgctatcaagaaactgagagacttccaggagatgttcggtctcaacaag
agactcagtgaactgggtgtgaaaaaagaggatattccaaagatggcagaaaccggctac
aggatactgaatggagtggttgtcgtaactcccggtaacctaaccgcaaaggatatggag
gagatattcaacaggtgttactga

DBGET integrated database retrieval system