KEGG   Thermotoga maritima MSB8: TM0137Help
Entry
TM0137            CDS       T00022                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tma  Thermotoga maritima MSB8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TM0137 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TM0137 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM0137 (trpA)
Enzymes [BR:tma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TM0137 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(142818..143537)
Genome map
AA seq 239 aa AA seqDB search
MKGFIAYIPAGFPDLETTRKILIALNELGITGVEIGVPFSDPVADGPVIQLAHSVALRNG
VTIKKILEMLSEISVDYDLYLMSYLNPIVNYPEGKEKLLDELKKLGVKGLIIPDLPLREV
KNVDIAYPIVPFVAPNTKDEEIDLINSVQAPFVYYISRYGVTGEREDLPFADHIKRVKER
IKLPLFVGFGISRHEQVKKVWEIADGVIVGSALVRIMEENPKDEIPRKVVEKVKELLGK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaagggctttattgcatacatccccgctggatttcccgatcttgaaacaacaaggaaa
atactgatcgctctcaacgaactcggcatcacaggtgtggagataggagttccgttctcc
gatccggtcgcagacggtcctgttattcagcttgcccacagcgtggctttgagaaacggt
gtcactataaaaaagattctggagatgctgagtgaaatatctgttgattacgatctctac
ctgatgagttatctgaatccgatagtgaactatccagagggaaaagaaaaactcctcgat
gaattgaaaaaactcggtgtgaagggcttgatcatacctgacctgcccttgagggaggta
aagaacgtcgatatagcgtatcccatagttcccttcgttgcaccgaacaccaaagacgag
gaaatagatttgatcaattccgttcaggctccgttcgtctattacatatcccggtacggt
gtcacaggtgagagggaagaccttcctttcgcggatcacataaagagggtgaaagaaaga
ataaaacttcctctcttcgtgggttttggaatctccaggcacgaacaggtgaaaaaggtg
tgggagatcgccgacggtgtgatcgtcggaagtgctcttgtgagaataatggaagaaaat
ccgaaggatgagattcccaggaaggttgttgagaaagtaaaagaactcctcggaaaatga

DBGET integrated database retrieval system