KEGG   Thermotoga maritima: TM0140Help
Entry
TM0140            CDS       T00022                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tma  Thermotoga maritima
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TM0140
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM0140
Enzymes [BR:tma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TM0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(145311..146003)
Genome map
AA seq 230 aa AA seqDB search
MIVQRRNHRFLEVLSGKERVKIIAEFKKASPSAGDINADASLEDFIRMYDELADAISILT
EKHYFKGDPAFVRAARNLTCRPILAKDFYIDTVQVKLASSVGADAILIIARILTAEQIKE
IYEAAEELGMDSLVEVHSREDLEKVFSVIRPKIIGINTRDLDTFEIKKNVLWELLPLVPD
DTVVVAESGIKDPRELKDLRGKVNAVLVGTSIMKAENPRRFLEEMRAWSE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgttcaaagaagaaaccacagatttctggaggttctgtcgggaaaagagagagtg
aagatcatagcggaattcaagaaggcttctccatctgctggagatataaacgctgatgct
tctctggaagatttcataaggatgtacgacgagctggcggatgcgatcagcatcctcacg
gaaaagcactatttcaaaggagatcctgccttcgtaagagcggcgagaaacttgacctgc
agacccattctcgctaaggacttctatatagacacggtccaggtgaaactggcttccagt
gtgggagcggacgccatccttataattgctcgaatactcactgcagagcagataaaagag
atctatgaagcggcggaagagctcggaatggacagtctcgtagaagtccactccagagaa
gatctggagaaggtcttttcggtgatcagaccgaagataatcggtatcaacacgagagat
ctggacactttcgagataaagaaaaatgtgctgtgggaacttctaccactcgtgccggat
gatacggttgtggtcgctgaaagtggcataaaagatcccagagaactcaaggatctgcgg
gggaaagtgaacgctgttctcgttggtacatccatcatgaaagccgaaaatccaagaaga
tttctagaagagatgagagcatggtcagagtga

DBGET integrated database retrieval system