KEGG   Thermotoga maritima: TM0140Help
Entry
TM0140            CDS       T00022                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tma  Thermotoga maritima
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tma01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tma00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(145311..146003)
Genome map
AA seq 230 aa AA seqDB search
MIVQRRNHRFLEVLSGKERVKIIAEFKKASPSAGDINADASLEDFIRMYDELADAISILT
EKHYFKGDPAFVRAARNLTCRPILAKDFYIDTVQVKLASSVGADAILIIARILTAEQIKE
IYEAAEELGMDSLVEVHSREDLEKVFSVIRPKIIGINTRDLDTFEIKKNVLWELLPLVPD
DTVVVAESGIKDPRELKDLRGKVNAVLVGTSIMKAENPRRFLEEMRAWSE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgttcaaagaagaaaccacagatttctggaggttctgtcgggaaaagagagagtg
aagatcatagcggaattcaagaaggcttctccatctgctggagatataaacgctgatgct
tctctggaagatttcataaggatgtacgacgagctggcggatgcgatcagcatcctcacg
gaaaagcactatttcaaaggagatcctgccttcgtaagagcggcgagaaacttgacctgc
agacccattctcgctaaggacttctatatagacacggtccaggtgaaactggcttccagt
gtgggagcggacgccatccttataattgctcgaatactcactgcagagcagataaaagag
atctatgaagcggcggaagagctcggaatggacagtctcgtagaagtccactccagagaa
gatctggagaaggtcttttcggtgatcagaccgaagataatcggtatcaacacgagagat
ctggacactttcgagataaagaaaaatgtgctgtgggaacttctaccactcgtgccggat
gatacggttgtggtcgctgaaagtggcataaaagatcccagagaactcaaggatctgcgg
gggaaagtgaacgctgttctcgttggtacatccatcatgaaagccgaaaatccaagaaga
tttctagaagagatgagagcatggtcagagtga

DBGET integrated database retrieval system