KEGG   Thermotoga maritima: TM0156Help
Entry
TM0156            CDS       T00022                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tma  Thermotoga maritima
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tma00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:tma00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tma02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(161933..163237)
Genome map
AA seq 434 aa AA seqDB search
MKRLFTLILISLLVALAFSQVKNVIYLIGDGMGLSQVYLTSMLEGRPLSFMKTPYIGLVK
THSANSWVTDSAAAGTALASGFKTNNGMINILPDGTVVPTIFEVAKTYGVRTGIVVTCRV
THATPAAFYAHVKSRDEENEIARQLVENETVDVVMGGGWANFLPKDLGGKRDDNLNLIEL
AKEKGYIYVKTREELSKISADSDKILALFAPSHLDPASSRKEQPMLYEMVEKALEILSKD
DEPFFLMVEGSQIDWEAHDNDIYGVWKEVVEFDKAVQVALDFALKRGDTLVIVTADHETG
GLGLSSGDYRVDVDKIRNFKKTTDWIMANYSPKDREKFKKAIEEYFGLTLSDEDLNRISM
SKNPKIELGRILGEKVSVGWTTTTHSGTPVPIFAFGPGAENFTGFLDNTEIPRIIMKLTG
YSLQYPLLKEPVTK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggctttttacactgatactgatttccctgctggtcgcgctcgctttttctcag
gtgaagaacgttatctacctcattggagacggtatgggtctttctcaagtctatctcacc
agcatgctcgaaggaagacccctctcgttcatgaagactccttacatcggacttgtgaag
acacactccgcaaacagctgggtgactgattccgcagcagcgggcacagcgctggcatcg
gggttcaaaacgaacaacggtatgatcaacattctccccgatggaacggtggtacccact
atcttcgaagtggcaaagacctacggagttcgaacgggtatcgttgttacctgcagagta
acacatgcgacgccggctgctttctacgcacacgttaaaagtagagatgaagagaacgaa
atagcaagacaactcgttgagaatgaaacagtcgatgtggtgatggggggaggttgggca
aactttcttcccaaggatctcggtggaaaacgagatgacaacctcaacttgattgaactt
gcaaaagaaaaagggtatatatacgtgaaaaccagagaggaactctcaaaaatctccgcg
gattcagataaaatactcgctctctttgcaccaagtcacctggatcctgcaagtagcaga
aaggagcagccgatgctctatgaaatggtggaaaaagcgctcgagatactgtcgaaagat
gatgaacccttcttcctcatggtggaaggctcccagatagactgggaagcccacgataac
gacatctacggggtctggaaagaagtcgtggaattcgacaaagccgttcaggtggcgctc
gatttcgccctcaagaggggagacaccctcgtcatcgtaactgccgaccacgaaacgggt
ggattagggctttcttcgggcgactacagagtagatgtggacaaaatcagaaacttcaaa
aaaacaacggactggatcatggcaaattactcgccaaaagatcgggagaaattcaaaaag
gccatcgaagagtatttcggtttgactctttctgatgaggatctgaacaggatttccatg
tccaaaaatccaaagatcgaacttggaaggatcctgggagaaaaggttagcgttgggtgg
accaccacaacacattcaggaactcccgttcccatcttcgcttttggtccgggtgccgaa
aacttcaccggatttctcgacaacaccgagattccaaggatcataatgaaactcacaggg
tactctcttcagtatccacttctgaaagaacccgtaacgaaatga

DBGET integrated database retrieval system