KEGG   Thermotoga maritima: TM0165Help
Entry
TM0165            CDS       T00022                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tma  Thermotoga maritima
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tma00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TM0165 (ruvA)
Enzymes [BR:tma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TM0165 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(170849..171424)
Genome map
AA seq 191 aa AA seqDB search
METMIAGISGRVLKKSGNVLLVETKSGVVFEIVCDVQTSEEVKEGGECFLHTFLSVSQDG
ITLYGFSNEMKKELFLSLTKVSRLGPKTALKIISNEDAETLVAMIASQDVEGLSKLPGIS
KKTAERIVMELKDEFESAGIKDMRIYHESLEALVSLGYPEKQAREAVKQVYREGMKTSEL
IKEALKFLSHR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtggaaactatgatagcgggaatctctggaagggttttgaaaaagagtggaaacgttctt
ctcgtagaaacaaaatccggtgtcgtcttcgaaatcgtctgcgacgttcaaaccagtgag
gaagtgaaagaaggcggggaatgttttcttcacacatttttgagcgtttcacaggatggc
atcaccctctacgggttttcaaacgaaatgaagaaggaactcttcctttctctcacaaag
gtttccaggcttgggccaaaaacggccctgaagatcatctcgaacgaagatgcggaaaca
ctggtagcaatgatcgcctctcaggacgtggaaggcctttcaaaacttcccggcatcagt
aagaaaacagcggaacggatcgtgatggaactgaaagatgaattcgaaagtgctggaata
aaagacatgagaatctatcatgaatccttagaagccctggtatcactgggatacccggag
aaacaggcaagagaagcggtgaaacaggtgtacagagagggaatgaaaacatccgagttg
ataaaagaagctttaaagtttctgagtcacagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system