KEGG   Thermotoga maritima MSB8: TM0209Help
Entry
TM0209            CDS       T00022                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00010  Glycolysis / Gluconeogenesis
tma00030  Pentose phosphate pathway
tma00051  Fructose and mannose metabolism
tma00052  Galactose metabolism
tma00680  Methane metabolism
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
tma01120  Microbial metabolism in diverse environments
tma01130  Biosynthesis of antibiotics
tma01200  Carbon metabolism
tma01230  Biosynthesis of amino acids
tma03018  RNA degradation
Module
tma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0209 (pfkA)
   00030 Pentose phosphate pathway
    TM0209 (pfkA)
   00051 Fructose and mannose metabolism
    TM0209 (pfkA)
   00052 Galactose metabolism
    TM0209 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    TM0209 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TM0209 (pfkA)
Enzymes [BR:tma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TM0209 (pfkA)
Protein phosphatases and associated proteins [BR:tma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TM0209 (pfkA)
Messenger RNA biogenesis [BR:tma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TM0209 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-GeneID: 897081
NCBI-ProteinID: NP_228024
UniProt: Q9WY52 G4FHC3
Position
complement(224640..225599)
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRYGVRQGLEVIGVRRGYSGLIDGDFVKLEYKDVAGI
TEKGGTILRTSRCEEFKTEEGRELAAKQIKKHGIEGLVVIGGEGSLTGAHLLYEEHKIPV
VGIPATIDNDIGLTDMCIGVDTCLNTVMDAVQKLKDTASSHERAFIVEVMGRHSGYIALM
AGLVTGAEAIIVPEIPVDYSQLADRILEERRRGKINSIIIVAEGAASAYTVARHLEYRIG
YETRITILGHVQRGGSPTAFDRRLALSMGVEAVDALLDGEVDVMIALQGNKFVRVPIMEA
LSTKKTIDKKLYEIAHMLS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagatagcagtacttacaagcggcggagacgcacctggaatgaacgcagctgtg
agagccgtggtcaggtacggtgtcaggcagggactggaagtgatcggagtgagaagaggt
tactcaggcctcatcgacggcgattttgtaaaactcgagtacaaagatgtggcaggaatc
acagaaaagggaggaacaattctgagaacttccagatgtgaggagttcaagacagaagag
ggcagggaactcgctgcgaaacagataaaaaaacatggtatagaaggactcgtcgtcata
ggtggtgaagggagtctcaccggcgctcatcttctttacgaagaacacaaaatacccgtt
gtcggtataccagcaaccatagacaacgacattgggttgactgacatgtgcataggggtg
gacacgtgtttgaacacggtgatggatgctgttcaaaagctcaaagacaccgctagctcg
catgagagagctttcattgtggaagtcatggggaggcattccggctacatcgctctcatg
gcgggactggtgactggtgcagaagccatcatcgtaccagagattccggtggattattca
cagctcgccgatagaattctcgaagaaaggagaagaggaaagatcaacagcataatcata
gtcgctgaaggggcagcgagtgcctataccgtcgcaagacacctcgaatacaggataggc
tacgaaacgaggatcaccatactcggacacgtacagagaggtggttctccaacggctttc
gacagaagactggcactgagtatgggagttgaagcggtcgatgctcttctggacggagag
gtagacgtgatgatagcgctccaagggaacaagttcgtgagagttcctataatggaagcg
ctctccacaaagaaaacgatcgacaaaaaactttacgaaatagcacatatgctttcatga

DBGET integrated database retrieval system