KEGG   Thermotoga maritima: TM0225Help
Entry
TM0225            CDS       T00022                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
tma  Thermotoga maritima
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TM0225
Enzymes [BR:tma01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     TM0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
239813..240751
Genome map
AA seq 312 aa AA seqDB search
MRIDLSLKPTPVQFLKRLSEKYGFNIYVKRDDLTELVGSGNKIRKLEYLLWEALKKGATT
VFTCGGLQSNHARATAYVSRRYGLKPVLFLRKGEKVLNGNLLLDILLGAEIVEVSPEEYE
RIDEIFDVHKKMREKKGEKVYVIPEGGSNSLGAFGYFNAVLEMKDQLNLESFDAIVCAVG
SGGTIAGLSAGISFLEYHVPVVGVNVTTKNSDYFVGKVKRIISGMEEYGLRVNETVFEVV
DDYRGPGYAIPSSEDVEILKEVASIEGIILDPVYTAKAFRGMIEMFRNSEKNVLFIHTGG
IFGLFAQSRRLV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgatctttcccttaaacccacacctgttcagtttctcaaaagactttcggaa
aaatacgggttcaacatctacgttaaaagagacgatctcacagagcttgtgggatcgggc
aacaaaatcagaaagctggagtatcttctatgggaagctcttaaaaaaggagcaacgact
gtcttcacctgtggaggtcttcagtcgaaccatgccagagcaacggcatacgtttcgaga
agatacggcttgaaacctgttctcttcctcagaaaaggggagaaggtactgaacggaaat
cttctcctcgacattctcctcggtgctgaaatagtggaggtatccccggaagagtacgaa
cgcatcgatgagatcttcgatgttcacaaaaagatgagagaaaagaaaggtgaaaaggtg
tacgtgatacccgaagggggatcgaactcccttggagcctttggctacttcaatgcggtg
ctggagatgaaagatcaattgaacctcgaatctttcgatgctattgtgtgtgctgttgga
agtggtggaaccatagcgggcttgtcagctggaatttcctttctggaatatcacgtaccc
gtagtgggtgtgaacgtcaccacgaaaaactcggattattttgtggggaaggtgaaaaga
ataattagtggtatggaagagtacggcctgagagtcaacgaaaccgttttcgaagtggtg
gacgattacagagggccgggatatgcgattccgtccagtgaggatgtggagatcttgaaa
gaagtagcttcgatagaaggcatcatcctcgatccggtctacacggcaaaagccttcaga
ggaatgatcgaaatgttcagaaactcagaaaagaacgttcttttcatccacacgggggga
atattcggtctgttcgcgcagagcaggaggttggtataa

DBGET integrated database retrieval system