KEGG   Thermotoga maritima: TM0237Help
Entry
TM0237            CDS       T00022                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tma  Thermotoga maritima
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TM0237
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TM0237
Enzymes [BR:tma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TM0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(251898..253370)
Genome map
AA seq 490 aa AA seqDB search
MNISTIVSNLKDLILEVRAPYDLEITGVSNHSSKVKKGDLFICRRGEKFDSHEIIPEVME
KGAVAVVVEREIDLDFPYIQVFDSRYFEAKVASLFFEDPWKDVLTFGVTGTNGKTTTTMM
IYHMLTSLGERGSVLTTAVKRILGNSYYDDITTPDAITILSAMKENREGGGKFFALEVSS
HALVQQRVEGVRFDVGIFTNISRDHLDFHGTFENYLKAKLHLFDLLKDDGVAVLNESLAD
AFNRKSRKITFGTSKNADYRLGNIEVSWEGTQFVLETPDGLLKVFTRAIGDFNAYNAAAA
IAALHQLGYDPKDLASSLETFTGVEGRFEVVRGAKKIGLNVVVDFAHSPDALEKLLKNVR
KISQGRVIVVFGAGGNSDRGKRPMMSEVASKLADVVILTTDDPRGEDPEQIMEDLIKGID
KRKPYLVLFDRREAIETALTIANRGDSVVIAGRGHERYQIIDEEKKVPFQDREVVEEIIR
DKLKGRKYAQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatcaactatcgtgtcgaatttaaaggatctcattttggaagttcgtgcaccc
tatgatctcgaaataacaggtgtgtccaaccactcttctaaggtaaaaaaaggagatctt
ttcatctgcagaagaggggagaagttcgattcccacgagataatacccgaagtgatggaa
aaaggagcagtggctgttgtcgttgaaagggaaatagatctggattttccctacattcag
gtttttgactcgcgctattttgaggcgaaagtggccagccttttcttcgaagatccctgg
aaagacgttttaacctttggagtcacaggaacaaatggcaaaaccacaacaaccatgatg
atctaccacatgctcacctctcttggagaaagaggaagcgttctcaccaccgctgtgaag
agaatccttggaaactcctactacgacgacatcaccacaccggatgcgatcaccatcctt
tccgccatgaaagaaaacagggaaggtggagggaagttcttcgccctcgaagtctcttcc
cacgcactggtccaacaaagggtcgaaggagtcagattcgatgtaggaatattcaccaac
atatcacgcgatcacctcgattttcacggcacattcgaaaactatctgaaagcaaagctt
cacctcttcgatctgctgaaagatgatggggtcgctgttctgaacgaatcactggcggac
gctttcaatcggaagtcgcgaaaaatcacctttggaacatcgaaaaacgccgattacagg
ctgggaaacatagaagtgagctgggaaggaacacagttcgttctggaaactcccgatggt
ttgctgaaggttttcacaagagcgataggagatttcaacgcctacaacgccgcggccgct
atcgcggctcttcaccagctcggatacgatccaaaagatctggcgagttcccttgagacg
ttcacaggggtcgagggaagattcgaagtagtacggggagcaaagaagatcgggctcaac
gtcgtcgtcgatttcgctcattctccagatgcactggaaaaattactgaaaaatgtcagg
aagatctctcagggaagagtgatagttgtcttcggggccgggggaaacagcgacagggga
aaacgtcccatgatgtccgaagttgcatcaaaactcgctgacgtcgtaatcctcacaacc
gatgatccacgaggggaagacccggaacagataatggaagacctgataaagggtatagat
aaacgcaaaccgtatctggtgctcttcgacagaagagaagccatcgaaacggctctaacc
atcgccaacagaggagattctgttgtcatagcggggagaggccatgaaagataccagata
atcgatgaagaaaagaaggtgccgttccaagacagagaagtcgtggaagagatcataaga
gacaagctgaaggggaggaaatacgcccaatga

DBGET integrated database retrieval system