KEGG   Thermotoga maritima MSB8: TM0282Help
Entry
TM0282            CDS       T00022                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00010  Glycolysis / Gluconeogenesis
tma00052  Galactose metabolism
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
tma01120  Microbial metabolism in diverse environments
tma01130  Biosynthesis of antibiotics
Module
tma_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0282
   00052 Galactose metabolism
    TM0282
Enzymes [BR:tma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     TM0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 897200
NCBI-ProteinID: NP_228094
UniProt: R4NPT5 Q9WYB8
Position
298101..299171
Genome map
AA seq 356 aa AA seqDB search
MEYLMSHIEKEFFGATSEGIPVYQYTLINKNGMMAKIITYGAIVRELWVPDSSGTLSDVV
LGFDTLQEYEAKNSNFFFGAIVGRYANRIAGGRFEIDGVTYQLALNDGDRPNALHGGVKG
FYTRVFKAVPMKTPTGPFLVLKYLSHDGEEGYPGNLDLTVIYTLTNENELKVEYRATTDK
PTVVNLTQHSYFNLSGEGTILDHELKINADSYTPVDDNLIPTGEIAPVEGTPFDLRSFKV
LRDAIEPLKSTTTKGFDINYVLNGEDGKLKLAAVLRDKRSRRRMEVYTTEPGLQLYTGNF
LDVKGKCGTYYGPYSGLCLEAQHFPDSPNHANFPSTILRPGEEYRQVTVYRFSVEV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaatatctgatgagccacattgaaaaggagttcttcggagcaacttctgagggaata
cctgtatatcagtacacactcataaacaaaaatggaatgatggcaaaaatcatcacttat
ggtgcgatagttagagagttgtgggtgccagacagttctggcaccctttctgatgttgtt
ttgggatttgacacgctccaggagtacgaagcaaagaactcgaacttcttcttcggagcg
atagtgggaagatacgcgaacagaatagccggtggaagattcgagatcgacggagtcacc
tatcagcttgccctgaacgatggagatcgcccaaacgcgctccacggtggtgtgaaggga
ttctacaccagggtcttcaaagccgtccccatgaaaacacccactggacctttccttgtt
ctgaagtatttgagccacgatggcgaagaaggctatcctggcaatctggatctcacagtt
atctacactctcacaaacgaaaacgagctgaaggtagagtatcgtgccacaacggataaa
cccaccgttgtgaacctcacacaacattcctacttcaatctctccggcgagggaacaatc
ctcgatcatgaactcaagataaacgcagacagttacacccccgttgatgataacctcata
ccaacaggagagattgcaccggttgaaggcacaccgttcgatttgagatctttcaaagtt
ctgagagacgccatcgaaccgttgaaaagcactacaacaaaaggtttcgatataaactac
gttttaaacggtgaagatggaaagctgaagcttgcagctgttctaagagacaagagatct
cgtcgaaggatggaggtctacacaacagagccgggtcttcaactctacacgggaaacttc
ctcgatgtgaagggaaaatgcggtacatactacggaccgtactcaggtttgtgtcttgaa
gcacagcacttccccgattctccaaatcatgcaaactttccaagcaccatcttgagacca
ggtgaggagtacagacaggttactgtttatagattttctgttgaagtttga

DBGET integrated database retrieval system