KEGG   Thermotoga maritima: TM0289Help
Entry
TM0289            CDS       T00022                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tma  Thermotoga maritima
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM0289
   01230 Biosynthesis of amino acids
    TM0289
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0289
   00030 Pentose phosphate pathway
    TM0289
   00051 Fructose and mannose metabolism
    TM0289
   00052 Galactose metabolism
    TM0289
  Energy metabolism
   00680 Methane metabolism
    TM0289
Enzymes [BR:tma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TM0289
Protein phosphatases and associated proteins [BR:tma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TM0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(306699..307958)
Genome map
AA seq 419 aa AA seqDB search
MAERLGILVGGGPAPGINSVISSVTIEAINNGLEVIGIYDGFKHLVEGKTNMVKKLSIED
VSRIHIEGGSILRTSRVNPAKSEETLEKTVQTLKKLGIKYLVTIGGDDTAFSASKVCERS
KGEIKVVHVPKTIDNDLPLPENMPTFGFETARHVATELVYNLMQDSRTTNRWYFVAMMGR
EAGHLALGVGKAASATITIIPEEFKEGVTLEEVCDVLDGAILKRKLMGRDDGVAVIGEGI
AEKMDPEELANIPGVIVEKDPHGHLRLAEIPLATILKRAIERRYAERGERIHIVDVTIGY
ELRSARPIPFDIVYTRTLGYGAVRFLLGDYSDLPGGMVCVVGGRIKILPFDAFMDPKTGR
TKVRVVDVRSEDYRVARKYMIRLEKKDLEDPETLEKLAKLAKMEPEEFKKKYWHTTELP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagattggggatactcgttggtggagggccggcacctggaatcaacagtgtg
ataagttctgttaccatcgaagctataaacaacggactcgaagtgatcggaatatacgat
ggattcaaacacctcgtagagggaaaaacgaatatggtgaaaaaactttccatcgaagat
gtctccagaatccacatcgaaggtggatccattctcagaacctcgagggtgaatcctgcc
aaatccgaagaaaccctcgagaagacagttcagactctcaaaaagctcgggataaagtat
cttgttactatcggcggggacgacaccgcgttctccgcgagcaaagtgtgtgaaagatcg
aagggcgaaataaaggtggtccacgttccaaagactatagacaacgatctccctcttccg
gagaacatgcccacgttcggtttcgaaacagctcgtcacgtagccacagagctcgtctac
aatctcatgcaagactcaagaacaacgaacaggtggtactttgtggccatgatgggaaga
gaagccgggcacctcgctctcggcgttggaaaagcggcgagtgcaacgatcacgatcatt
cctgaagagttcaaagagggagtgacgctcgaagaagtgtgcgacgttcttgatggagcg
attctcaagagaaaactcatgggaagagacgatggagtggcggtcataggtgaaggtatc
gcagaaaagatggatcctgaagaactcgccaacattcccggtgtgatagtcgaaaaagac
ccacacggacacctgagacttgcagagatcccgctcgccaccattctgaaacgggcgatc
gagaggagatacgctgaaagaggtgaaagaatccacatcgtcgatgtcacaataggatac
gaactcagaagcgcacgccctatacctttcgacatagtatacaccagaacactcggttac
ggtgcagtgagatttctccttggagactattccgatctccctggcgggatggtgtgcgtg
gttggtggcagaatcaagattcttcccttcgacgctttcatggatccaaagaccggaagg
acaaaggtgagagtggtggatgttcgatcggaagattacagagtagcaagaaaatacatg
ataaggctggaaaagaaagatctcgaagatcccgaaactctcgaaaaactagcaaagctc
gcaaagatggaacctgaagaattcaaaaagaaatactggcatacgacagagcttccataa

DBGET integrated database retrieval system