KEGG   Thermotoga maritima: TM0310Help
Entry
TM0310            CDS       T00022                                 

Definition
beta-D-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tma  Thermotoga maritima
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TM0310
Enzymes [BR:tma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TM0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
333534..335552
Genome map
AA seq 672 aa AA seqDB search
MVNPKLPVIWYGGDYYPEQWDEETFERDIRMFKEAGINVVTIGVFSWSLIQPDENTYDFS
FFEKVMDRLYKEGIYVCLATPTSAPPHWMTQKYPEILFTDVNGVKREKGGRQNFCPNSEK
YRYFARNIAEKLAEHFKDHPALVLWHVNNEYLNYCYCDICRGKFQNWLKEKYGTLDELNR
RWNTRFWSQTFTAWEEIPVPTTRSVLVWRKDRYQSVLPELYLDYRRFMTQSMLECFLEEY
RAIKKHTPDIPVTTNLIAATFKEWNYFEWAKHMDVAAWDNYPGYKEDFSVISLRHSLIRC
LKEGKPFVLMEQSPSQACWRWYNPQKRPGEMRLWSYHALAHGAETLMFFQLRQSKGGVEK
FHGAVITHVDSPNTRVFQEVKRVGEEIKSLSDILDARVVSQTALLFDWESWWAMEDTLTP
SVDFRYLNEVQKYFKALVKTGLGVDVVGKDQNFERYRVLVAPVLYMVGKELAQKLKDYVS
NGGILILTTMSGIVDEDDQVVLGGYPGYLRDLMGGYVEEIDALPPEEKNEILMFGKRYEC
SLVFDYIKTTTAEVLGRFGRDYYMNEPAVLRNNYGKGWVYYVGSSTSFDLVWDLVKFMER
EHNLRAEIAPPDDVEVIKKIKGEKIFYFLFNHSHELQIVDLPEGMFRDLIKGNLYEKKVK
LQPLDVLILLKE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaatccgaaacttcctgtgatctggtacggaggagactactacccggaacagtgg
gacgaggaaacgttcgaaagagatattaggatgttcaaagaagcaggtatcaacgtggtc
accatcggggttttctcatggagtcttatccaaccagacgagaacacctacgatttttcg
ttctttgaaaaagtaatggatcgcctgtacaaagaaggtatctacgtctgtcttgcaact
cccacatccgctccccctcactggatgacgcagaaataccctgaaatccttttcacagac
gtgaacggtgtaaagcgagaaaagggaggcagacagaacttttgccccaacagtgagaag
tacagatattttgcaagaaacattgcagagaaactcgcagaacatttcaaggatcatcct
gctctcgttctctggcacgtgaacaacgaatacctgaactactgctactgtgatatctgc
agggggaagtttcagaactggttgaaggaaaagtacggcacactcgatgaattgaacaga
agatggaacacacggttctggtcccagaccttcaccgcctgggaagagattcctgttcca
acaacgaggagtgttctcgtctggagaaaggacaggtatcaatctgttcttccagaactt
tatctggattacagacgcttcatgacacagagtatgctcgagtgtttcctggaggaatac
agggcaataaagaaacacactcccgacatacccgtcaccacgaatctgattgcggcaact
ttcaaggagtggaactatttcgaatgggcgaagcatatggacgttgcagcatgggacaac
tatcccggttacaaagaagatttctccgtgatttctttgagacactctctgatacgctgt
ttgaaagaaggaaaacccttcgtcctgatggaacagtctccttcgcaggcgtgctggaga
tggtacaatccccagaaaagacccggagagatgaggctctggagttatcacgctctcgct
cacggtgctgaaacgctcatgttctttcagctgagacaatcaaaaggaggagtagaaaaa
ttccacggggctgttatcacacatgtcgacagtccgaacacaagggtctttcaggaagtg
aaaagagtgggagaagagataaagtccttatcggatattctcgacgcaagggttgtctca
cagacagcccttctgttcgattgggaaagctggtgggcgatggaagacaccctgacacct
agcgtagacttcaggtatttaaacgaagtgcagaagtacttcaaggcacttgtgaaaacc
ggccttggagtcgatgttgttgggaaagatcagaattttgaaaggtacagagtcctcgtt
gctccggtgctttatatggtgggcaaagaacttgcacagaagctgaaagattacgtctcg
aacggaggaatcttgatcctcacaacaatgagtggtattgtcgatgaagacgatcaggtt
gttctgggaggttatccaggttatcttcgcgatcttatggggggctatgtggaagaaata
gatgctttgccacctgaagagaagaacgaaatcttgatgtttggcaagaggtacgaatgt
agtttggtgtttgactacataaaaaccaccaccgcggaagtactcggaagatttggaagg
gactattacatgaacgaacctgccgtgttgagaaacaactacggcaaaggatgggtttac
tacgtaggctcttccacgtctttcgatcttgtatgggatcttgtgaagttcatggagaga
gaacacaatctcagagcagagatcgcaccgccagatgatgtagaagtgataaagaaaatc
aaaggggaaaaaattttctacttcctcttcaatcattcccatgaactacagatcgttgat
ttgccggaaggaatgttcagggatctgatcaaaggaaatttgtatgagaaaaaagtaaaa
ttgcaaccgctcgatgttctgatccttctaaaagaatga

DBGET integrated database retrieval system