KEGG   Thermotoga maritima: TM0364Help
Entry
TM0364            CDS       T00022                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tma  Thermotoga maritima
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TM0364
Enzymes [BR:tma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TM0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
382025..383350
Genome map
AA seq 441 aa AA seqDB search
MIGYQIYVRSFRDGNLDGVGDFRGLKNAVSYLKELGIDFVWLMPVFSSISFHGYDVVDFY
SFKAEYGSEREFKEMIEAFHDSGIKVVLDLPIHHTGFLHTWFQKALKGDPHYRDYYVWAN
KETDLDERREWDGEKIWHPLEDGRFYRGLFGPFSPDLNYDNPQVFDEMKRLVLHLLDMGV
DGFRFDAAKHMRDTIEQNVRFWKYFLSDLKGIFLAEIWAEARMVDEHGRIFGYMLNFDTS
HCIKEAVWKENTRVLIESIERAVIGKDYLPVNFTSNHDMSRLASFEGGFSKEKIKLSISI
LFTLPGVPLVFYGDELGMKGVYQKPNTEVVLDPFPWNESMCVEGQTFWKWPAYNGPFSGI
SVEYQKRDPDSILSHTLGWTRFRKENQWIDRAKLEFLCKEDKFLVYRLYDDQHSLKVFHN
LSGEEVVFEGVKMKPYKTEVV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgataggctatcagatctacgtgagatctttcagggatggaaacctcgacggtgtggga
gatttcaggggattgaaaaacgctgtttcctacctgaaagaactggggattgactttgtc
tggctcatgcctgttttttcctccatatcttttcacgggtacgacgtggtggatttttat
tctttcaaagctgagtacggtagtgagagagagttcaaagagatgatcgaggcattccac
gacagcggaataaaagtcgttcttgaccttcccatccatcacacaggctttctccacacg
tggttccagaaggcgctgaaaggagatccacactacagagattactacgtatgggcaaac
aaagagacggatctggacgaaagaagagagtgggatggagaaaagatctggcatcccctg
gaagatgggaggttctacagagggctctttggacctttctcacccgacttgaactacgac
aacccgcaggtattcgatgaaatgaaaagactggttctccaccttctcgatatgggagtg
gatggtttcaggttcgatgcagcaaagcacatgagagatacgatcgaacagaatgttcgc
ttctggaagtactttctttccgatttgaagggcatcttcctcgcagagatatgggcagag
gccagaatggtggatgaacacggcagaatatttggctacatgctcaactttgacacatcc
cactgtataaaggaagctgtatggaaagagaacacaagagttctgatagagtcgatcgaa
agggccgttatcggcaaagactacctcccggtgaattttacttcgaatcacgacatgtcg
aggcttgcaagctttgaaggaggcttcagcaaagaaaagatcaaactttcgatttccatt
cttttcactctcccgggagttcctctcgtgttctatggggatgagcttggaatgaaggga
gtttaccagaaaccgaacacagaagtcgtcctggatccgttcccgtggaacgagagtatg
tgcgttgagggacagaccttctggaagtggcccgcgtacaacgggcctttctctggtatc
tccgtagaataccagaagagagatcccgattcgattctttcacacactctgggatggacg
agattcagaaaggaaaaccagtggatcgatcgggcaaagctcgaatttttgtgtaaagag
gacaagtttcttgtgtacagactctacgatgatcagcattctttgaaggtgtttcacaat
ctttcaggggaagaggttgtctttgagggagttaaaatgaagccttacaaaacggaggtg
gtttga

DBGET integrated database retrieval system