KEGG   Thermotoga maritima: TM0408Help
Entry
TM0408            CDS       T00022                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tma  Thermotoga maritima
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tma02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tma02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
426306..427340
Genome map
AA seq 344 aa AA seqDB search
MTDRVIRVLVVDDSAFMRMVLKDIIDSQPDMKVVGFAKDGLEAVEKAIELKPDVITMDIE
MPNLNGIEALKLIMKKAPTRVIMVSSLTEEGAAITIEALRNGAVDFITKPHGSISLTFRQ
VAPELLEKIRQAMNVDPRTLLFKPKVSRLTITKPAVSGKIVVIGSSTGGPRSLDMIIPNL
PKNFPAPIVVVQHMPPGFTKSLAMRLDSTSELTVKEAEDGEEVKPGFVYIAPGDFHLGLK
AQNGKVFFFLDKSDKINNVRPAVDFTLDKAAEIYKSKTIAVILTGMGKDGTKGAFKVKFY
GGTVIAEDKETCVVFGMPKSVIEEGYADYVLPAYKIPEKLIELV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagggtgataagagtactggtagtagatgactcggcgttcatgagaatggta
ctcaaggacatcatagattctcagccggacatgaaagtagtggggttcgctaaagacggt
ttggaagccgttgaaaaagctatagagctcaaaccagacgtcataaccatggacatcgaa
atgccgaatctgaacggtattgaagcgctgaagctcatcatgaaaaaagctcccacacga
gtcatcatggtgagcagtttgacggaagaaggtgcggcgatcacaatagaagctctcaga
aacggtgcggtggatttcatcaccaagccacacggttcgatttctctcaccttcagacaa
gttgccccggaacttctggagaaaatcagacaggcaatgaacgtggatccacgcactctc
ctctttaagccgaaggtttcacggctcaccataaccaaaccagctgtaagtgggaaaatc
gtggttataggttcctcaaccggagggcccagatcgctcgatatgatcatcccaaacctt
ccgaaaaacttcccagctccaatagttgtggtccagcacatgcctcctggtttcacaaaa
tcgctcgcaatgaggctggatagcacctctgaactcaccgtgaaagaggccgaagatgga
gaagaggtcaagcccggttttgtttatatcgctcccggggactttcaccttggtttgaag
gcccagaacggcaaggtttttttcttcctggacaagtctgataaaataaacaacgtgagg
ccagcggtggatttcaccctcgacaaagcagcggagatatacaaatccaaaacgatagct
gtgattctcacgggtatgggcaaagatggcaccaagggagcattcaaggtcaagttttac
ggtggaacggtaatagccgaggacaaagaaacatgtgtcgtctttggaatgcccaaatcg
gtgatcgaggaaggttacgctgattacgtccttccggcctataaaatacctgagaagctg
atagaactcgtatga

DBGET integrated database retrieval system