KEGG   Thermotoga maritima MSB8: TM0408Help
Entry
TM0408            CDS       T00022                                 

Definition
(RefSeq) chemotaxis-specific methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma02020  Two-component system
tma02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tma00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TM0408
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TM0408
Enzymes [BR:tma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     TM0408
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     TM0408
Two-component system [BR:tma02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   TM0408
Bacterial motility proteins [BR:tma02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TM0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-GeneID: 897407
NCBI-ProteinID: NP_228218
UniProt: Q9WYN9 G4FHW7
Structure
PDB: 

Jmol
Position
426306..427340
Genome map
AA seq 344 aa AA seqDB search
MTDRVIRVLVVDDSAFMRMVLKDIIDSQPDMKVVGFAKDGLEAVEKAIELKPDVITMDIE
MPNLNGIEALKLIMKKAPTRVIMVSSLTEEGAAITIEALRNGAVDFITKPHGSISLTFRQ
VAPELLEKIRQAMNVDPRTLLFKPKVSRLTITKPAVSGKIVVIGSSTGGPRSLDMIIPNL
PKNFPAPIVVVQHMPPGFTKSLAMRLDSTSELTVKEAEDGEEVKPGFVYIAPGDFHLGLK
AQNGKVFFFLDKSDKINNVRPAVDFTLDKAAEIYKSKTIAVILTGMGKDGTKGAFKVKFY
GGTVIAEDKETCVVFGMPKSVIEEGYADYVLPAYKIPEKLIELV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagggtgataagagtactggtagtagatgactcggcgttcatgagaatggta
ctcaaggacatcatagattctcagccggacatgaaagtagtggggttcgctaaagacggt
ttggaagccgttgaaaaagctatagagctcaaaccagacgtcataaccatggacatcgaa
atgccgaatctgaacggtattgaagcgctgaagctcatcatgaaaaaagctcccacacga
gtcatcatggtgagcagtttgacggaagaaggtgcggcgatcacaatagaagctctcaga
aacggtgcggtggatttcatcaccaagccacacggttcgatttctctcaccttcagacaa
gttgccccggaacttctggagaaaatcagacaggcaatgaacgtggatccacgcactctc
ctctttaagccgaaggtttcacggctcaccataaccaaaccagctgtaagtgggaaaatc
gtggttataggttcctcaaccggagggcccagatcgctcgatatgatcatcccaaacctt
ccgaaaaacttcccagctccaatagttgtggtccagcacatgcctcctggtttcacaaaa
tcgctcgcaatgaggctggatagcacctctgaactcaccgtgaaagaggccgaagatgga
gaagaggtcaagcccggttttgtttatatcgctcccggggactttcaccttggtttgaag
gcccagaacggcaaggtttttttcttcctggacaagtctgataaaataaacaacgtgagg
ccagcggtggatttcaccctcgacaaagcagcggagatatacaaatccaaaacgatagct
gtgattctcacgggtatgggcaaagatggcaccaagggagcattcaaggtcaagttttac
ggtggaacggtaatagccgaggacaaagaaacatgtgtcgtctttggaatgcccaaatcg
gtgatcgaggaaggttacgctgattacgtccttccggcctataaaatacctgagaagctg
atagaactcgtatga

DBGET integrated database retrieval system