KEGG   Thermotoga maritima MSB8: TM0539Help
Entry
TM0539            CDS       T00022                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tma  Thermotoga maritima MSB8
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TM0539
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TM0539
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TM0539
Enzymes [BR:tma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TM0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(564612..565880)
Genome map
AA seq 422 aa AA seqDB search
MRIVVNLKPEEIPKHWYNVLADLPFKLDPPLDPETKQPISPEKLSVIFPMSLIEQEVSEE
RFIEIPEPVLKEYAVYRPTPLIRATFLEEYLQTPARIYYKYEGVSPTGSHKPNTAIAQAY
YNKIEGVKRLVTETGAGQWGSALSYAGAKFGLEVKVFMVKVSYQQKPMRKYMMNLFGGKV
TPSPSEETNFGRKILSEDPDNPGSLGIAISEALEVAVSDPNTKYSLGSVLNHVLLHQTVI
GLEIKKQLELIGEKPDILLGCHGGGSNFGGTILPFVPDKLSGRDIRFVACEPAACPSLTK
GNYDYDFGDTAGLTPLLKMYTLGKDFIPPKIHAGGLRYHGSAPIIARLVKEGLVEAQAFD
QDETFEAAKIFAKLEGIIPAPESAHAIAGAIREAKKAKEEGKERVIVFTLSGHGLLDLTA
YV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgttgtgaatttgaaacctgaggaaattccaaagcactggtacaacgtactc
gcagatcttccgttcaaactcgatccgccgctggaccccgaaacgaaacaacccatttca
cccgagaagctctctgttatcttccccatgagtctgatcgaacaggaggtctcagaagag
cggttcatcgaaatacccgagcccgttctgaaagaatacgccgtttacagacccactccc
ctcatcagagccactttcttagaagagtacctccagactccggcgaggatctactacaag
tacgaaggagtgagccccactggaagccacaagccgaacacggccatcgcccaggcctac
tacaacaagatagaaggagtcaaaagactcgtcacagaaacgggagcgggacaatggggc
agcgctctctcgtacgccggtgccaagttcggattggaagtaaaagtgttcatggtgaag
gtcagctaccagcaaaaaccgatgagaaaatacatgatgaaccttttcggaggaaaggta
actccaagtcccagtgaagaaacgaatttcggaagaaagatcctgagtgaagatccagac
aatccaggtagtcttggcatcgccatcagtgaagcactggaagtggccgtgtctgatccg
aacacgaagtactccctcggaagcgtattgaaccatgttctgctccaccagacggttata
ggcctcgagatcaagaaacagctcgaactcataggtgaaaaaccagacatcttactggga
tgtcacggaggaggatcgaattttggaggaacgatacttcccttcgttccagacaaactt
tccggaagggatatcaggttcgttgcctgcgagcccgccgcgtgtccatccctgacaaaa
gggaattacgattacgacttcggtgacaccgcaggactcacacctctgctgaaaatgtac
acccttggaaaggacttcattcctccgaagatacacgcgggaggtctcagataccacggc
tccgctccgataatcgcaagactcgtgaaagaaggactcgtggaggcacaggctttcgat
caggacgagacgttcgaggcagcgaagatcttcgcaaagctcgaagggataattcccgcc
ccggaatccgctcacgccatcgcaggagccataagggaagcaaagaaagcgaaagaagaa
ggaaaagaacgtgtgatagtattcactctgagcggccacggtctgctcgatcttacagcg
tacgtgtga

DBGET integrated database retrieval system