KEGG   Thermotoga maritima: TM0679Help
Entry
TM0679            CDS       T00022                                 

Definition
flagellar motor switch protein FliM
Orthology
K02416  
flagellar motor switch protein FliM
Organism
tma  Thermotoga maritima
Pathway
Bacterial chemotaxis
Flagellar assembly
Class
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tma02030]
Cellular Processes; Cell motility; Flagellar assembly [PATH:tma02040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
705947..706933
Genome map
AA seq 328 aa AA seqDB search
MSDVLSQEEINQLIEALMKGELKEEDLLKEEEEKKVKPYDFKRPSKFSKEQLRTFQMIHE
NFGRALSTYLSGRLRTFVDVEISIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRL
DLFYTMLDIIMGGPGENPPNRPPTEIETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVE
TNPQFVQIVPPNEIVLLVTASVSWGEFTSFINVCWPFSLLEPLLEKLSDRFWMMGRKPEK
VEERMEELRKASQKIPVTVQAVIGETELRLKEILDLEVGDVIRLGTHYKDEIRIDVEGRP
KFRGIPGVFKGKYAVKVTGEFTNGGEYE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggatgttctcagccaggaagaaataaaccagttgatcgaggcattgatgaaaggt
gaattgaaggaagaagacctcctgaaggaagaagaggagaaaaaggttaagccttacgat
ttcaagaggccgagcaaattttccaaagaacaacttcgaacctttcagatgatacacgaa
aacttcgggagggccctctctacgtatctctcaggaaggctgagaacttttgtggatgtc
gaaatcagcatagatcagcttacttatgaggaattcataagatccgtgatgataccttcg
ttcattgttatcttcaccggtgatgtttttgagggaagcgccatcttcgaaatgagactg
gatctcttttataccatgcttgacatcataatgggaggccccggcgaaaaccctccaaac
agacctcccacggagatagaaacctccataatgagaaaagaagtgaccaacatgctaacc
cttcttgctcaggcctggagtgattttcaatatttcattccttcgatagaaaacgtggag
acgaatcctcaattcgttcagattgtacctcccaacgagatcgttcttcttgtaaccgcc
tccgtttcctggggcgaattcacaagcttcatcaacgtgtgctggccgttttcacttctt
gagcctttgctcgaaaagctttcggatcgcttctggatgatgggaagaaaacccgaaaaa
gttgaagagagaatggaagagctcagaaaagcttcccaaaagatacctgtgactgtccag
gcggtgataggagaaactgagttgagattgaaggaaattctggatctggaagtgggagac
gtcataaggcttgggactcactacaaggatgaaataagaatagacgttgaggggagaccc
aagttcaggggaattcccggagtgttcaaaggaaagtacgcggtgaaggtgaccggtgaa
ttcaccaacggaggtgaatacgaatga

DBGET integrated database retrieval system