KEGG   Thermotoga maritima: TM0679Help
Entry
TM0679            CDS       T00022                                 

Definition
flagellar motor switch protein FliM
Orthology
K02416  
flagellar motor switch protein FliM
Organism
tma  Thermotoga maritima
Pathway
Bacterial chemotaxis
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:tma00001]
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TM0679
   02040 Flagellar assembly
    TM0679
Bacterial motility proteins [BR:tma02035]
 Flagellar system
  Flagellar assembly proteins
   C-ring
    TM0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
705947..706933
Genome map
AA seq 328 aa AA seqDB search
MSDVLSQEEINQLIEALMKGELKEEDLLKEEEEKKVKPYDFKRPSKFSKEQLRTFQMIHE
NFGRALSTYLSGRLRTFVDVEISIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRL
DLFYTMLDIIMGGPGENPPNRPPTEIETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVE
TNPQFVQIVPPNEIVLLVTASVSWGEFTSFINVCWPFSLLEPLLEKLSDRFWMMGRKPEK
VEERMEELRKASQKIPVTVQAVIGETELRLKEILDLEVGDVIRLGTHYKDEIRIDVEGRP
KFRGIPGVFKGKYAVKVTGEFTNGGEYE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggatgttctcagccaggaagaaataaaccagttgatcgaggcattgatgaaaggt
gaattgaaggaagaagacctcctgaaggaagaagaggagaaaaaggttaagccttacgat
ttcaagaggccgagcaaattttccaaagaacaacttcgaacctttcagatgatacacgaa
aacttcgggagggccctctctacgtatctctcaggaaggctgagaacttttgtggatgtc
gaaatcagcatagatcagcttacttatgaggaattcataagatccgtgatgataccttcg
ttcattgttatcttcaccggtgatgtttttgagggaagcgccatcttcgaaatgagactg
gatctcttttataccatgcttgacatcataatgggaggccccggcgaaaaccctccaaac
agacctcccacggagatagaaacctccataatgagaaaagaagtgaccaacatgctaacc
cttcttgctcaggcctggagtgattttcaatatttcattccttcgatagaaaacgtggag
acgaatcctcaattcgttcagattgtacctcccaacgagatcgttcttcttgtaaccgcc
tccgtttcctggggcgaattcacaagcttcatcaacgtgtgctggccgttttcacttctt
gagcctttgctcgaaaagctttcggatcgcttctggatgatgggaagaaaacccgaaaaa
gttgaagagagaatggaagagctcagaaaagcttcccaaaagatacctgtgactgtccag
gcggtgataggagaaactgagttgagattgaaggaaattctggatctggaagtgggagac
gtcataaggcttgggactcactacaaggatgaaataagaatagacgttgaggggagaccc
aagttcaggggaattcccggagtgttcaaaggaaagtacgcggtgaaggtgaccggtgaa
ttcaccaacggaggtgaatacgaatga

DBGET integrated database retrieval system