KEGG   Thermotoga maritima: TM0689Help
Entry
TM0689            CDS       T00022                                 

Definition
bifunctional phosphoglycerate kinase/triosephosphate isomerase
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tma  Thermotoga maritima
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tma01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tma01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tma00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tma00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tma00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
714303..716267
Genome map
AA seq 654 aa AA seqDB search
MEKMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHL
GRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFH
PGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSK
VTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEE
DKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPET
IELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAV
NKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIADKKKITRKLILAGNWKMHKTISEAK
KFVSLLVNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQGAFTGEISP
LMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTF
CVVEKQVREGFYGLDKEEAKRVVIAYEPVWAIGTGRVATPQQAQEVHAFIRKLLSEMYDE
ETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFIELARIMRGVIS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgaccataagagatgttgatctgaaaggcaagagagtcataatgagagtg
gacttcaacgttccagtgaaggatggggtcgttcaggacgacacgagaataagagccgcc
cttccaacgataaagtacgctcttgaacagggtgcaaaggtgatactcctgtcccatctt
ggaaggcccaagggagaaccttcaccagagttcagcctcgcacctgtcgccaaaagactc
tctgagcttcttggaaaagaagtgaagtttgttcccgctgttgtcggtgatgaggtgaaa
aaggccgttgaggagctcaaagagggagaggttctcctccttgaaaacaccagattccac
ccgggagagaccaagaacgatcctgaactcgcgaagttctgggctagcctcgccgatatt
cacgtgaacgatgccttcggaacggcgcacagggcacacgcttccaacgttggaatcgca
cagtttattcccagcgtagcgggattcctcatggaaaaagagataaagttcctttccaag
gtgacttataatccagaaaaaccgtacgttgtggttcttggaggagcaaaggtatctgac
aaaatcggcgtcatcacgaacctcatggagaaagccgacagaattctcataggtggagcc
atgatgttcaccttcctgaaggctcttggcaaagaggttggatcgtccagggttgaagaa
gacaagatcgacctcgcaaaagaactcctcgaaaaagcgaaagaaaagggtgttgagatc
gttcttcccgttgatgccgttatcgctcagaagatcgaacccggtgtggaaaagaaggtt
gtcagaatcgacgacgggatacccgaaggatggatgggcctcgacataggacccgagaca
attgagctcttcaagcagaagctctccgatgcaaaaaccgttgtctggaacgggccaatg
ggagtcttcgaaatagacgatttcgctgaaggcacgaagcaggtcgcacttgcgatcgca
gcgctcacggaaaagggagcgatcaccgttgtgggtggaggagacagcgccgcggcggtg
aacaagttcggtctggaagacaaattctcccacgtttcaacgggcggaggggcttctctc
gaattccttgaaggaaaagaacttcctggtattgccagcatcgcggataaaaaaaaaata
actcgtaaactgatcctcgctgggaactggaagatgcataaaacgatctcggaagcgaaa
aagtttgtgtcgctgctcgtgaacgaacttcacgacgtgaaagagttcgaaatagtggtc
tgtcctccgttcacagctctatctgaagtgggggaaatactctctggtagaaacatcaaa
ttgggagctcaaaacgttttctacgaagaccagggagcgttcaccggggagatttctcct
ctcatgctgcaagagatcggcgttgaatacgtgatcgtgggacattccgagagaaggcgt
attttcaaagaagacgacgagttcataaacaggaaagtgaaagcggtgcttgaaaaaggt
atgactcctattctctgcgttggagaaacactcgaggaaagagagaaagggctcactttc
tgcgttgtggaaaaacaggtgagagaaggtttctacggtctcgacaaagaggaagcaaag
agagtggtaatagcttacgagccagtctgggcaatcgggacaggaagggtggcgacacca
cagcaggcacaggaagtacacgcgttcataagaaagctgctctcagagatgtacgacgag
gaaacagcgggatcgataaggattctctacggtggaagcataaagccggacaatttcctc
ggtctcatcgttcagaaggatatagatggtggtctcgttggaggagcgagtctcaaagag
tctttcatagaacttgcacgaataatgagaggtgtgatttcctga

DBGET integrated database retrieval system