KEGG   Thermotoga maritima: TM0689Help
Entry
TM0689            CDS       T00022                                 

Definition
bifunctional phosphoglycerate kinase/triosephosphate isomerase
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tma  Thermotoga maritima
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TM0689
   01230 Biosynthesis of amino acids
    TM0689
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0689
   00051 Fructose and mannose metabolism
    TM0689
   00562 Inositol phosphate metabolism
    TM0689
Enzymes [BR:tma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     TM0689
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TM0689
Exosome [BR:tma04147]
 Exosomal proteins
  Proteins found in most exosomes
   TM0689
  Exosomal proteins of colorectal cancer cells
   TM0689
  Exosomal proteins of bladder cancer cells
   TM0689
  Exosomal proteins of melanoma cells
   TM0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
714303..716267
Genome map
AA seq 654 aa AA seqDB search
MEKMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHL
GRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFH
PGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSK
VTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEE
DKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPET
IELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAV
NKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIADKKKITRKLILAGNWKMHKTISEAK
KFVSLLVNELHDVKEFEIVVCPPFTALSEVGEILSGRNIKLGAQNVFYEDQGAFTGEISP
LMLQEIGVEYVIVGHSERRRIFKEDDEFINRKVKAVLEKGMTPILCVGETLEEREKGLTF
CVVEKQVREGFYGLDKEEAKRVVIAYEPVWAIGTGRVATPQQAQEVHAFIRKLLSEMYDE
ETAGSIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFIELARIMRGVIS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgaccataagagatgttgatctgaaaggcaagagagtcataatgagagtg
gacttcaacgttccagtgaaggatggggtcgttcaggacgacacgagaataagagccgcc
cttccaacgataaagtacgctcttgaacagggtgcaaaggtgatactcctgtcccatctt
ggaaggcccaagggagaaccttcaccagagttcagcctcgcacctgtcgccaaaagactc
tctgagcttcttggaaaagaagtgaagtttgttcccgctgttgtcggtgatgaggtgaaa
aaggccgttgaggagctcaaagagggagaggttctcctccttgaaaacaccagattccac
ccgggagagaccaagaacgatcctgaactcgcgaagttctgggctagcctcgccgatatt
cacgtgaacgatgccttcggaacggcgcacagggcacacgcttccaacgttggaatcgca
cagtttattcccagcgtagcgggattcctcatggaaaaagagataaagttcctttccaag
gtgacttataatccagaaaaaccgtacgttgtggttcttggaggagcaaaggtatctgac
aaaatcggcgtcatcacgaacctcatggagaaagccgacagaattctcataggtggagcc
atgatgttcaccttcctgaaggctcttggcaaagaggttggatcgtccagggttgaagaa
gacaagatcgacctcgcaaaagaactcctcgaaaaagcgaaagaaaagggtgttgagatc
gttcttcccgttgatgccgttatcgctcagaagatcgaacccggtgtggaaaagaaggtt
gtcagaatcgacgacgggatacccgaaggatggatgggcctcgacataggacccgagaca
attgagctcttcaagcagaagctctccgatgcaaaaaccgttgtctggaacgggccaatg
ggagtcttcgaaatagacgatttcgctgaaggcacgaagcaggtcgcacttgcgatcgca
gcgctcacggaaaagggagcgatcaccgttgtgggtggaggagacagcgccgcggcggtg
aacaagttcggtctggaagacaaattctcccacgtttcaacgggcggaggggcttctctc
gaattccttgaaggaaaagaacttcctggtattgccagcatcgcggataaaaaaaaaata
actcgtaaactgatcctcgctgggaactggaagatgcataaaacgatctcggaagcgaaa
aagtttgtgtcgctgctcgtgaacgaacttcacgacgtgaaagagttcgaaatagtggtc
tgtcctccgttcacagctctatctgaagtgggggaaatactctctggtagaaacatcaaa
ttgggagctcaaaacgttttctacgaagaccagggagcgttcaccggggagatttctcct
ctcatgctgcaagagatcggcgttgaatacgtgatcgtgggacattccgagagaaggcgt
attttcaaagaagacgacgagttcataaacaggaaagtgaaagcggtgcttgaaaaaggt
atgactcctattctctgcgttggagaaacactcgaggaaagagagaaagggctcactttc
tgcgttgtggaaaaacaggtgagagaaggtttctacggtctcgacaaagaggaagcaaag
agagtggtaatagcttacgagccagtctgggcaatcgggacaggaagggtggcgacacca
cagcaggcacaggaagtacacgcgttcataagaaagctgctctcagagatgtacgacgag
gaaacagcgggatcgataaggattctctacggtggaagcataaagccggacaatttcctc
ggtctcatcgttcagaaggatatagatggtggtctcgttggaggagcgagtctcaaagag
tctttcatagaacttgcacgaataatgagaggtgtgatttcctga

DBGET integrated database retrieval system