KEGG   Thermotoga maritima: TM0704Help
Entry
TM0704            CDS       T00022                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tma  Thermotoga maritima
Brite
Enzymes [BR:tma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TM0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
726192..727145
Genome map
AA seq 317 aa AA seqDB search
MREKLFWILKKYGVSDHIAKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQ
PSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNV
ERLGIENVIFVCGDGYYGVPEFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINLKLS
RRQPAFLFKKKDPYLVGNYKLETRFITAGGNLGNLLERNRKLLREFPFNREILLVRSHIF
VELVDLLTRRLTEIDGTFYYAGPNGVVEFLDDRMRIYGDAPEIENLLTQWESCGYRSFEY
LMLHVGYNAFSHISCSI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaagctcttttggattcttaaaaagtacggtgtgagcgatcacatcgcgaag
gcttttctggaaataccccgtgaggagttcctgacgaagtcctacccactctcttacgtt
tacgaggatatcgttctggtttcctacgatgatggagaagaatacagcacttccagtcag
ccctctttgatggcgctgtttatggagtgggtgggtctggacaaaggaatgagagtcctc
gaaataggcggaggaacgggttacaacgctgccgtgatgagcagagttgtgggtgagaaa
ggccttgtggtctccgtggaatattcgaggaaaatctgcgagatcgcgaaaaggaacgtg
gaacgccttggaatagagaacgttatttttgtctgtggcgatggatactacggtgttccg
gagttttccccgtacgatgttatcttcgtaacagtcggtgtggatgaggtgccggagacg
tggttcactcaactcaaagaaggtgggagggtgatagtacctatcaatttgaaactttca
agaagacagcccgctttcctgttcaaaaaaaaggatccgtatcttgtgggaaactacaaa
ctggaaaccaggttcataacggcagggggcaatctcggaaatcttctcgagaggaacaga
aagcttttgagagaatttccattcaacagagagatcttactcgtacgttctcatatcttc
gtggagctggtggatctcctcaccaggagactcacagagattgatggaacgttctactac
gctgggccaaacggcgtggtagagtttctcgatgacaggatgagaatctacggggacgct
ccagagatagagaaccttttaactcagtgggaaagctgcggctacaggagcttcgagtat
ctcatgcttcatgtgggttacaacgctttttcacatatatcctgttctatttga

DBGET integrated database retrieval system