KEGG   Thermotoga maritima: TM0809Help
Entry
TM0809            CDS       T00022                                 

Definition
hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tma  Thermotoga maritima
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tma00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:tma00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
832384..833787
Genome map
AA seq 467 aa AA seqDB search
MDVDLGKLFFCGFNDFNEEVKEIIRKYRPTGILIYPGVLSKEYLLMDFMSFLSKEGDFLI
SSDHEGGQLEVLKYVPSSPGNLAFGKNSPDVTYRYSRVAGKIMEIVGLNMVFAPVLDLLS
EESSSVIDIRSYGSDPKIVAEHGARACEGYLEGGVIPCIKHFPGHGKAREDSHLTLPVVD
APFEKLWEEDLLPFRKVLEREKKVTVMTAHVRYSSIDSLPATLSEKIITDVLREKIGFDG
LVISDAMEMSAVSNNFSVEEIVSLFLNAGGNMILLGDYRNLPVYYETLVKLLEDGKVQKD
KVERSIRTVEKYLAFAKKNSGVGFLADVSMKAVEFLGFEKIDHTSEVTLLVPSSENLSQA
DTTGGDYDQIPEIVSRFFEVENVVRYTVEDGPEFVEGDLIFDFVADIPNEKALKAHLSLP
AEKTVYFVLRNPFDVRYFEGRKIVVTRSTKPISIYKSLEHFLGRCDS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggatcttggaaagctgttcttctgcggtttcaatgacttcaacgaggaagtc
aaggaaataatcagaaaatacagaccaaccggtattttgatctatccaggagttctttcg
aaagagtaccttctgatggatttcatgagttttctatcgaaggaaggagattttctcatc
agttccgatcacgagggtggccagcttgaggtgttgaaatacgttccctcgtctccggga
aatcttgcctttgggaaaaactcaccggatgtgacttacagatattccagggttgcggga
aagatcatggagattgtggggctcaacatggtttttgctcctgttcttgatcttctttct
gaagagagttcttcggtgatcgacataagaagctacggctcagatcccaaaatcgtagcc
gagcacggagcaagagcctgtgaaggttatctggaaggtggagttattccctgcatcaag
cactttccaggtcacggaaaagcgagagaagactctcacctcacccttcctgtagtcgat
gcaccctttgaaaaactctgggaagaggatcttctgccgttcagaaaggtgctggaaagg
gagaaaaaggtcacggtcatgacggcccacgtcagatactcttcgatagacagtctcccg
gctactctttcggagaagatcataacggacgttctcagagaaaagatcggtttcgacggt
cttgtgatcagtgacgctatggagatgagcgctgtgtcgaacaatttctctgttgaagag
attgtgagtctctttctgaacgcgggaggaaacatgatccttctcggtgattacagaaat
cttccggtttactatgaaacgctggtgaaactcctcgaggatggaaaggtccagaaggac
aaagtggagcgctccataagaacggtggaaaaatatcttgcttttgcgaagaaaaacagc
ggtgttggtttccttgccgatgtttcgatgaaggctgtggaattcctcggttttgaaaag
atagatcataccagtgaagtgactcttctcgttccttccagtgagaatctgagtcaggca
gacaccacggggggcgattacgatcagattccggagatcgtttccagatttttcgaagtc
gagaatgttgttcgatacaccgtagaagacggtcccgagttcgttgaaggtgatttgatc
ttcgattttgtagccgacataccgaacgaaaaggctttgaaagcccatctgagccttccg
gcagaaaagaccgtttacttcgttctgagaaatccgttcgatgtcaggtatttcgaagga
agaaagatagtcgtcacaagatcgacgaaacccatttctatctataaatccttagaacat
tttttagggaggtgtgattcatga

DBGET integrated database retrieval system