KEGG   Thermotoga maritima: TM0809Help
Entry
TM0809            CDS       T00022                                 

Definition
hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tma  Thermotoga maritima
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TM0809
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TM0809
Enzymes [BR:tma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TM0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
832384..833787
Genome map
AA seq 467 aa AA seqDB search
MDVDLGKLFFCGFNDFNEEVKEIIRKYRPTGILIYPGVLSKEYLLMDFMSFLSKEGDFLI
SSDHEGGQLEVLKYVPSSPGNLAFGKNSPDVTYRYSRVAGKIMEIVGLNMVFAPVLDLLS
EESSSVIDIRSYGSDPKIVAEHGARACEGYLEGGVIPCIKHFPGHGKAREDSHLTLPVVD
APFEKLWEEDLLPFRKVLEREKKVTVMTAHVRYSSIDSLPATLSEKIITDVLREKIGFDG
LVISDAMEMSAVSNNFSVEEIVSLFLNAGGNMILLGDYRNLPVYYETLVKLLEDGKVQKD
KVERSIRTVEKYLAFAKKNSGVGFLADVSMKAVEFLGFEKIDHTSEVTLLVPSSENLSQA
DTTGGDYDQIPEIVSRFFEVENVVRYTVEDGPEFVEGDLIFDFVADIPNEKALKAHLSLP
AEKTVYFVLRNPFDVRYFEGRKIVVTRSTKPISIYKSLEHFLGRCDS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggatcttggaaagctgttcttctgcggtttcaatgacttcaacgaggaagtc
aaggaaataatcagaaaatacagaccaaccggtattttgatctatccaggagttctttcg
aaagagtaccttctgatggatttcatgagttttctatcgaaggaaggagattttctcatc
agttccgatcacgagggtggccagcttgaggtgttgaaatacgttccctcgtctccggga
aatcttgcctttgggaaaaactcaccggatgtgacttacagatattccagggttgcggga
aagatcatggagattgtggggctcaacatggtttttgctcctgttcttgatcttctttct
gaagagagttcttcggtgatcgacataagaagctacggctcagatcccaaaatcgtagcc
gagcacggagcaagagcctgtgaaggttatctggaaggtggagttattccctgcatcaag
cactttccaggtcacggaaaagcgagagaagactctcacctcacccttcctgtagtcgat
gcaccctttgaaaaactctgggaagaggatcttctgccgttcagaaaggtgctggaaagg
gagaaaaaggtcacggtcatgacggcccacgtcagatactcttcgatagacagtctcccg
gctactctttcggagaagatcataacggacgttctcagagaaaagatcggtttcgacggt
cttgtgatcagtgacgctatggagatgagcgctgtgtcgaacaatttctctgttgaagag
attgtgagtctctttctgaacgcgggaggaaacatgatccttctcggtgattacagaaat
cttccggtttactatgaaacgctggtgaaactcctcgaggatggaaaggtccagaaggac
aaagtggagcgctccataagaacggtggaaaaatatcttgcttttgcgaagaaaaacagc
ggtgttggtttccttgccgatgtttcgatgaaggctgtggaattcctcggttttgaaaag
atagatcataccagtgaagtgactcttctcgttccttccagtgagaatctgagtcaggca
gacaccacggggggcgattacgatcagattccggagatcgtttccagatttttcgaagtc
gagaatgttgttcgatacaccgtagaagacggtcccgagttcgttgaaggtgatttgatc
ttcgattttgtagccgacataccgaacgaaaaggctttgaaagcccatctgagccttccg
gcagaaaagaccgtttacttcgttctgagaaatccgttcgatgtcaggtatttcgaagga
agaaagatagtcgtcacaagatcgacgaaacccatttctatctataaatccttagaacat
tttttagggaggtgtgattcatga

DBGET integrated database retrieval system