KEGG   Thermotoga maritima MSB8: TM0889Help
Entry
TM0889            CDS       T00022                                 

Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00900  Terpenoid backbone biosynthesis
tma01100  Metabolic pathways
tma01110  Biosynthesis of secondary metabolites
tma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TM0889
Enzymes [BR:tma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TM0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 898563
NCBI-ProteinID: NP_228697
UniProt: Q9WZZ1 G4FCT6
Structure
PDB: 

Jmol
Position
911387..912517
Genome map
AA seq 376 aa AA seqDB search
MEERTLVILGATGSIGTQTLDVLKKVKGIRLIGISFHSNLELAFKIVKEFNVKNVAITGD
VEFEDSSINVWKGSHSIEEMLEALKPDITMVAVSGFSGLRAVLASLEHSKRVCLANKESL
VCGGFLVKKKLKEKGTELIPVDSEHSAIFQVMEPEVEKVVLTASGGALRDWKISKIDRAR
PEDVLKHPVWNMGARITVDSATMVNKAFEVLEAMELFELPFEKIEVKIHREGLVHGAVVL
PDGNVKMVVSPPDMRIPISYALFYPRRVALEPFFLRTISLSFEDPDPEKYPAFFLLKEIK
DSYALRTAFNAADEVAVEAFLKGRIRFGGIHRVIEKTLEEFQGYPQPRTLDDVERIHFEA
IKKAERVTEWLSSTSY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagaaccctcgtgatactgggtgccactggatccatagggactcagacactc
gatgttttgaaaaaagtgaaaggaattcgattgataggtatctcgtttcacagcaatctg
gagctggccttcaagatcgtgaaagaattcaacgtgaagaacgtggcgatcacgggtgat
gtggagttcgaagacagttcgatcaatgtctggaaaggttctcattccatagaagagatg
ctggaagcgctgaagcctgacatcacaatggtagcagtttcgggattcagtggattgagg
gcggtgcttgcgtctctagaacactcgaaaagggtgtgtcttgcgaacaaagaatctctc
gtgtgcggcggatttctggtgaagaaaaaactcaaagagaaaggaacggaacttattcca
gtcgatagtgaacacagcgccatctttcaggtgatggagccagaagtggaaaaggtggtt
ttgacagcttctggaggtgctttgagagactggaaaatttccaagatcgatagagcaagg
cctgaagacgtactcaagcatcccgtgtggaatatgggagcccgtataacggtagattct
gctacaatggtgaacaaggcgttcgaagttctggaagccatggaacttttcgagctgccc
ttcgagaagatagaagtgaagatacacagagagggattggttcacggagcagtggttctg
cccgatggaaacgtcaaaatggtggtgtcaccaccggatatgagaataccgataagttat
gcccttttctatccgagacgcgtcgctcttgaaccgttttttctgaggaccattagcctt
tcttttgaagatcccgatcccgaaaaataccctgcgttctttcttctgaaagagataaag
gattcttacgctctgagaacagctttcaacgcggcagatgaagtggcagtcgaagccttt
ttgaaggggagaataaggttcggtggtatccacagagtgatagagaaaactctcgaagag
tttcaaggatatccacagccacgaacgctggatgatgtggagcgaattcatttcgaagcg
ataaaaaaagcggagagggtgacagaatggttatcgtctacttcatattga

DBGET integrated database retrieval system