KEGG   Thermotoga maritima: TM0920Help
Entry
TM0920            CDS       T00022                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tma  Thermotoga maritima
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TM0920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TM0920
  Lipid metabolism
   00071 Fatty acid degradation
    TM0920
  Amino acid metabolism
   00350 Tyrosine metabolism
    TM0920
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TM0920
   00626 Naphthalene degradation
    TM0920
Enzymes [BR:tma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TM0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
938313..939392
Genome map
AA seq 359 aa AA seqDB search
MWEFYMPTDVFFGEKILEKRGNIIDLLGKRALVVTGKSSSKKNGSLDDLKKLLDETEISY
EIFDEVEENPSFDNVMKAVERYRNDSFDFVVGLGGGSPMDFAKAVAVLLKEKDLSVEDLY
DREKVKHWLPVVEIPTTAGTGSEVTPYSILTDPEGNKRGCTLMFPVYAFLDPRYTYSMSD
ELTLSTGVDALSHAVEGYLSRKSTPPSDALAIEAMKIIHRNLPKAIEGNREARKKMFVAS
CLAGMVIAQTGTTLAHALGYPLTTEKGIKHGKATGMVLPFVMEVMKEEIPEKVDTVNHIF
GGSLLKFLKELGLYEKVAVSSEELEKWVEKGSRAKHLKNTPGTFTPEKIRNIYREALGV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgtgggaattctacatgcccacggatgtcttttttggagaaaaaatcctcgagaagaga
ggaaacataatagatcttcttggaaaaagagctttggtagtaaccggcaaatcttcttcg
aaaaagaacggatctctcgatgatctgaaaaagcttctcgacgaaacagaaatatcctac
gagatcttcgatgaagtcgaggagaatccgtctttcgacaacgttatgaaggctgttgag
agatacagaaacgattctttcgatttcgtcgtgggactcggtggaggaagccctatggat
ttcgccaaggcggtggccgtacttttgaaagagaaagatctttccgtcgaagatctttac
gatagagaaaaagtgaagcactggcttccagtcgtggagataccaaccaccgctggaacg
ggtagtgaagtcactccgtattccatactcaccgatccagagggaaacaaaagaggttgt
acactcatgtttccggtgtacgcgtttctcgatcccagatacacctactccatgtcagat
gaactgaccttatcgactggagtcgatgcgctttctcatgcggtcgaaggatacctttct
agaaagagtacgccgccttccgatgccctcgcgatcgaagccatgaagataattcacagg
aatttaccgaaggccattgaaggaaacagagaagccagaaagaagatgttcgtggcctcc
tgccttgccgggatggtgattgcgcaaactgggaccacactggcgcacgctctgggttat
cctctaacaacggagaagggaataaaacacgggaaagcgacaggtatggtactaccattt
gtaatggaggtaatgaaagaagaaattccagaaaaggtggatactgtgaatcacatattc
ggcggcagtcttttgaaatttctgaaagaactcggactttacgaaaaagtggcagtttcc
tctgaagaactggagaagtgggtcgaaaagggttccagagcgaaacatctcaaaaacacg
ccgggtaccttcactcccgaaaagatcagaaacatatacagggaggcactcggggtgtga

DBGET integrated database retrieval system