KEGG   Thermotoga maritima: TM0960Help
Entry
TM0960            CDS       T00022                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tma  Thermotoga maritima
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TM0960
Enzymes [BR:tma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TM0960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(977224..978123)
Genome map
AA seq 299 aa AA seqDB search
MFLVISVVGSSNIDIVLKVDHFTKPGETQKAIEMNVFPGGKGANQAVTVAKIGEKGCRFV
TCIGNDDYSDLLIENYEKLGITGYIRVSLPTGRAFIEVDKTGQNRIIIFPGANAELKKEL
IDWNTLSESDILLLQNEIPFETTLECAKRFNGIVIFDPAPAQGINEEIFQYLDYLTPNEK
EIEALSKDFFGEFLTVEKAAEKFLELGVKNVIVKLGDKGVLLVNKNEKKHFPTFKVKAVD
TTAAGDVFNGAFAVALSEGKNPEEAVIFGTAAAAISVTRLGAQSSIPAREEVEAFLKNL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagtgatttccgtcgtggggagttcaaacatagatatcgttctgaaggttgat
cacttcacaaaacctggtgaaacccagaaagcgatagagatgaacgtttttccgggtgga
aaaggggcgaatcaggctgtaacagtcgcaaaaattggagagaaaggatgccgttttgta
acgtgcattggaaacgatgattactctgatctgctcatagagaattacgaaaaactcgga
ataactggatatataagagttagtcttcctacaggaagagcgttcatagaagtcgataaa
acaggacaaaacaggatcatcatctttcctggagcgaacgccgaactgaaaaaagaattg
attgattggaatacgctctctgaaagtgatatccttctccttcaaaacgaaattcctttt
gaaaccaccttggaatgtgcgaaaagattcaatggaattgtgatctttgaccccgcaccc
gcgcagggaataaacgaagaaatctttcagtacctggactatctcacaccgaatgaaaaa
gagatcgaagccctgtcgaaagatttcttcggtgagtttttgacggttgagaaagccgct
gagaagtttctggaactcggcgtcaagaatgtgatagtgaagctcggtgacaaaggagta
cttcttgtgaacaaaaatgaaaagaaacactttccgaccttcaaagtaaaggctgtggac
acaacagcggcgggggacgtgttcaatggagcttttgccgttgctctgtctgagggaaaa
aatcccgaagaggcggtaatctttggaacggcagcagcggccatatcggtaacaaggttg
ggagctcaaagttctattccagcgagagaagaagtagaggcgtttttgaagaatttatga

DBGET integrated database retrieval system