KEGG   Thermotoga maritima: TM1022Help
Entry
TM1022            CDS       T00022                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tma  Thermotoga maritima
Brite
Enzymes [BR:tma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TM1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1041647..1042408)
Genome map
AA seq 253 aa AA seqDB search
MNFPRCKTVKKSLPIFLEGGNEGVLFIHGYTGSPHDFEYMAKEVNRAGFTVSVPRLPGHG
TCGEDFLTTTARDWLRRAFDAYYDLKAICDRVYVVGLSMGGVIALILASQMNPPKLVTLA
AATHVFDKRIVLTPILKLFTKKMPCENTEKYEDPDIEYLRKEYWSYNWPKQAAELYKLMK
LARKSVSKITSATLVVAAKNDNMVPMKAAEFIYNNIRSEKRKLLVFEKSGHVLSNDVEKE
DVTRAVIEWLKGE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccacgatgtaaaactgtgaagaagtcgcttccgatctttcttgagggagga
aacgaaggggttcttttcatccatggatacaccggttctccacacgatttcgagtacatg
gcaaaggaggtaaacagagccggctttaccgtttctgttccgagacttccaggacacgga
acctgcggtgaggattttctgacgacaaccgctcgagactggctgagacgcgctttcgat
gcatattacgatttaaaagccatatgcgatagagtctatgtggtgggactttccatgggt
ggtgtgattgctctgatccttgcctctcagatgaatcctcccaaactggtcacactggct
gcagcaactcatgtgttcgacaaaagaatagttctcacaccgattctgaagttgtttacg
aagaagatgccttgtgaaaacacagaaaagtacgaagacccggacatcgaatacctgaga
aaagagtactggtcttacaactggccaaaacaggcagctgagctttacaaactcatgaaa
ctggcaagaaagagtgtttcaaagatcacatcagccactctcgtcgtcgcggcaaaaaac
gacaacatggttcccatgaaggcagccgagttcatatacaacaacatcagatcagaaaag
aggaagcttcttgtttttgaaaaatccggtcacgttctgagcaacgatgtggaaaaggaa
gatgtcaccagagcagttatcgagtggctgaagggggaatga

DBGET integrated database retrieval system