KEGG   Thermotoga maritima MSB8: TM1049Help
Entry
TM1049            CDS       T00022                                 

Definition
(RefSeq) endoglucanase
Organism
tma  Thermotoga maritima MSB8
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1064625..1065644
Genome map
AA seq 339 aa AA seqDB search
MYLKELSMMPGVSGDEGKVRDFIKSKIEGLVDNLYTDVLGNLIALKRGRDSSKKLLVSAH
MDEVGFVVSKIEKDGKVSFLPVGGVDPRILPGKVVQVKNLKGVIGYRPIHLQRDEENTPP
RFENLRIDFGFSSADEAKKYVSIGDYVSFVSDYIEKNGRAVGKAFDDRAGCSVLIDVLES
GVSPAYDTYFVFTVQEETGLRGSAVVVEQLKPTCAIVVETTTAGDNPELEERKWATHLGD
GPAITFYHRGYVIPKEIFQTIVDTAKNNDIPFQMKRRTAGGTDAGRYARTAYGVPAGVIS
TPARYIHSPNSIIDLNDYENTKKLIKVLVEEGKIVEVVS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtatctcaaagagctttcgatgatgccgggtgtgtctggagatgaagggaaggtcagg
gatttcataaagtcaaagatagaaggtcttgttgacaacctttacaccgatgtccttggg
aatttgatagctttgaaaagaggaagagattcttcgaaaaaactgctcgtttcggctcac
atggatgaggtcggtttcgttgtgagcaaaatagaaaaggacggaaaagtgtcgttcttg
cccgttgggggagtcgatcccaggatacttcccggaaaggtggttcaggtgaagaatctc
aaaggagttatcggctacagaccgatccaccttcagcgcgatgaagagaacactccccca
aggtttgagaacctgagaattgatttcggtttttcttcggcagacgaagcgaaaaagtac
gtatcaataggagactacgtctctttcgtgagtgattacatcgaaaagaacggccgggca
gtcgggaaagcgttcgacgacagagcgggttgttctgttctgatcgatgttctcgaaagt
ggtgtgagtcccgcttacgacacgtactttgtcttcacagttcaagaagagacgggtctt
cgtggaagtgcagttgtggtggaacagctgaaacccacctgtgccatcgtcgtggaaacc
accacggccggcgacaatccggaactggaggaaaggaaatgggcaacacatctgggtgac
ggtcctgccatcaccttttaccacagaggatacgtgatcccaaaggagatctttcagacc
atcgtggatacggcgaagaacaacgacattccgtttcagatgaagagaagaaccgctggg
ggaacggacgcgggacgttacgccagaaccgcctacggagtaccagcaggtgtgatctcc
actccagctcggtacattcacagtccgaattcgatcatagatttgaacgactacgaaaac
acgaagaaactcataaaagtacttgtcgaggaaggaaaaatcgtggaggtggtctcatga

DBGET integrated database retrieval system