KEGG   Thermotoga maritima MSB8: TM1050Help
Entry
TM1050            CDS       T00022                                 

Definition
(RefSeq) endoglucanase
Organism
tma  Thermotoga maritima MSB8
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1065641..1066636
Genome map
AA seq 331 aa AA seqDB search
MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAH
IDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVR
KLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVF
KRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSG
GPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVS
IPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaactgatcagaaagctgacggaagccttcggcccaagtggacgggaagaagag
gtgagaagtatcatcctcgaggaactcgaagggcacatagatggccacaggatcgatggg
ctcggcaatctcattgtctggaaaggaagcggcgagaaaaaggtgatactggacgctcac
atagatgagataggtgttgtcgtcacaaacgtggacgacaagggatttctgacaatagaa
cccgtcggcggtgtctctccgtacatgcttcttggaaaaaggatcaggttcgaaaacggt
acaataggcgttgttggtatggaaggtgaaacaacagaagaaaggcaggagaatgtgaga
aagctctcgttcgacaagctgttcatcgatatcggtgcaaattccagagaagaagcacag
aagatgtgcccaattggaagcttcggtgtctacgacagtggattcgtcgaagtttccggg
aaatacgtctcgaaggcgatggatgacaggataggatgtgccgtgatcgtggaagttttc
aaaagaatcaaacccgctgttacgctctacggtgttttcagtgttcaggaagaagtggga
ctggtcggtgcctcggtggcggggtacggcgtaccagcggacgaggccatcgcgatcgat
gtgactgattcggcagacactccgaaggccatcaagagacacgcaatgaggctctccggt
ggacccgctctgaaagtgaaagacagggcatcgatcagcagcaaacgcatcctcgaaaat
ttgatagaaatcgcggaaaaattcgatataaagtatcagatggaggttctgacgttcggc
ggtacgaacgccatggggtaccagcggactagagaagggattccttcggccacggtgtct
attcccacacgatacgttcactcacccagtgagatgatcgcaccagatgatgttgaggca
acggtcgatcttctcatcaggtatctgggggcgtga

DBGET integrated database retrieval system