KEGG   Thermotoga maritima: TM1071Help
Entry
TM1071            CDS       T00022                                 

Definition
sugar isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tma  Thermotoga maritima
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TM1071
   00051 Fructose and mannose metabolism
    TM1071
Enzymes [BR:tma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     TM1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1086305..1087456
Genome map
AA seq 383 aa AA seqDB search
MINMERIFKELDELKFELPSWAFSDAGTRFAVFHEEGAARNVFERIEDAALVHRLTGCCP
SVALHIPWDKVENWEELREFAEEKGLKIGAINPNLFQDPDYKYGSLTNPSEKIRKKAIAH
VMECVDIAEKTGSKVISLWLADGTDYPGQDDFRSRKKRLEESLRYIYENMPADMYLLIEY
KFFEPAFYHTDIPDWGMSYLLSEKLGERALVLVDLGHHPQGTNIEYIVATLLSEKKLGGF
HLNNRKYADDDLTIASINPYEVFLIFKEIVFAKRDPELSDSAKKVVLMFDQAHITKPKIL
AMIQSVLIAQELFTKALLIDENRLREAQKNYDVVEAEEILLDAFRTDVRPILREYRRQKG
LPEDPLRVFREEDYMEKRRRERR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgataaacatggaaaggatttttaaggagctggacgagttgaagttcgaacttccctcc
tgggcgttcagcgatgcaggaacaaggtttgctgtcttccacgaagaaggagccgcccgg
aacgtttttgaaaggatagaagacgctgctctcgttcatcgtctcacaggttgttgtcct
tccgttgcccttcacattccctgggacaaagtggaaaactgggaggaactgagagagttt
gctgaagagaaaggcttgaagataggtgccatcaacccgaatctgtttcaggatcctgat
tataagtacggaagcctcacgaatcccagcgaaaagatcagaaaaaaagcgatcgctcac
gtaatggagtgcgtggacatagccgaaaaaactggttcaaaggtgatcagtctgtggctc
gcggacggaacggactatcctggtcaggacgatttccgctccaggaagaaaaggctcgaa
gagtccctgaggtacatctacgagaacatgccggctgatatgtacctcctcatagagtac
aagttcttcgagcccgctttttatcacactgacattccagactggggaatgagctatctc
ctttcggaaaaattgggagaacgtgctcttgtactcgtcgacctggggcatcatccccag
ggaacgaacatagagtacatcgttgcaacacttctgtctgagaagaaactcggtggtttt
cacctgaacaacaggaaatacgcagatgacgatctcacgatcgcctccataaatccgtac
gaggtgtttttgatcttcaaggagatcgtctttgcgaagagagatcctgaactctctgat
tctgcaaagaaggtggttctcatgttcgatcaggcccacatcacaaaaccgaagatcctc
gcgatgatacaatctgttttgatcgcccaggaacttttcacaaaggcacttctcatagat
gaaaatcgactgagagaggctcagaaaaactacgacgtggttgaagcagaagaaattctt
ctcgatgcgtttcgaacagacgtaaggccgattctgagggagtacagaaggcagaaaggt
cttccggaggatccgctcagagtctttcgggaagaagactacatggaaaaaagaaggaga
gagagacgatga

DBGET integrated database retrieval system