KEGG   Thermotoga maritima: TM1071Help
Entry
TM1071            CDS       T00022                                 

Definition
sugar isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tma  Thermotoga maritima
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tma00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tma00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1086305..1087456
Genome map
AA seq 383 aa AA seqDB search
MINMERIFKELDELKFELPSWAFSDAGTRFAVFHEEGAARNVFERIEDAALVHRLTGCCP
SVALHIPWDKVENWEELREFAEEKGLKIGAINPNLFQDPDYKYGSLTNPSEKIRKKAIAH
VMECVDIAEKTGSKVISLWLADGTDYPGQDDFRSRKKRLEESLRYIYENMPADMYLLIEY
KFFEPAFYHTDIPDWGMSYLLSEKLGERALVLVDLGHHPQGTNIEYIVATLLSEKKLGGF
HLNNRKYADDDLTIASINPYEVFLIFKEIVFAKRDPELSDSAKKVVLMFDQAHITKPKIL
AMIQSVLIAQELFTKALLIDENRLREAQKNYDVVEAEEILLDAFRTDVRPILREYRRQKG
LPEDPLRVFREEDYMEKRRRERR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgataaacatggaaaggatttttaaggagctggacgagttgaagttcgaacttccctcc
tgggcgttcagcgatgcaggaacaaggtttgctgtcttccacgaagaaggagccgcccgg
aacgtttttgaaaggatagaagacgctgctctcgttcatcgtctcacaggttgttgtcct
tccgttgcccttcacattccctgggacaaagtggaaaactgggaggaactgagagagttt
gctgaagagaaaggcttgaagataggtgccatcaacccgaatctgtttcaggatcctgat
tataagtacggaagcctcacgaatcccagcgaaaagatcagaaaaaaagcgatcgctcac
gtaatggagtgcgtggacatagccgaaaaaactggttcaaaggtgatcagtctgtggctc
gcggacggaacggactatcctggtcaggacgatttccgctccaggaagaaaaggctcgaa
gagtccctgaggtacatctacgagaacatgccggctgatatgtacctcctcatagagtac
aagttcttcgagcccgctttttatcacactgacattccagactggggaatgagctatctc
ctttcggaaaaattgggagaacgtgctcttgtactcgtcgacctggggcatcatccccag
ggaacgaacatagagtacatcgttgcaacacttctgtctgagaagaaactcggtggtttt
cacctgaacaacaggaaatacgcagatgacgatctcacgatcgcctccataaatccgtac
gaggtgtttttgatcttcaaggagatcgtctttgcgaagagagatcctgaactctctgat
tctgcaaagaaggtggttctcatgttcgatcaggcccacatcacaaaaccgaagatcctc
gcgatgatacaatctgttttgatcgcccaggaacttttcacaaaggcacttctcatagat
gaaaatcgactgagagaggctcagaaaaactacgacgtggttgaagcagaagaaattctt
ctcgatgcgtttcgaacagacgtaaggccgattctgagggagtacagaaggcagaaaggt
cttccggaggatccgctcagagtctttcgggaagaagactacatggaaaaaagaaggaga
gagagacgatga

DBGET integrated database retrieval system