KEGG   Thermotoga maritima: TM1192Help
Entry
TM1192            CDS       T00022                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tma  Thermotoga maritima
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tma00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tma00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tma00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1209118..1210776)
Genome map
AA seq 552 aa AA seqDB search
MEIFGKTFREGRFVLKEKNFTVEFAVEKIHLGWKISGRVKGSPGRLEVLRTKAPEKVLVN
NWQSWGPCRVVDAFSFKPPEIDPNWRYTASVVPDVLERNLQSDYFVAEEGKVYGFLSSKI
AHPFFAVEDGELVAYLEYFDVEFDDFVPLEPLVVLEDPNTPLLLEKYAELVGMENNARVP
KHTPTGWCSWYHYFLDLTWEETLKNLKLAKNFPFEVFQIDDAYEKDIGDWLVTRGDFPSV
EEMAKVIAENGFIPGIWTAPFSVSETSDVFNEHPDWVVKENGEPKMAYRNWNKKIYALDL
SKDEVLNWLFDLFSSLRKMGYRYFKIDFLFAGAVPGERKKNITPIQAFRKGIETIRKAVG
EDSFILGCGSPLLPAVGCVDGMRIGPDTAPFWGEHIEDNGAPAARWALRNAITRYFMHDR
FWLNDPDCLILREEKTDLTQKEKELYSYTCGVLDNMIIESDDLSLVRDHGKKVLKETLEL
LGGRPRVQNIMSEDLRYEIVSSGTLSGNVKIVVDLNSREYHLEKEGKSSLKKRVVKREDG
RNFYFYEEGERE
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatattcggaaagaccttcagagagggaagattcgttctcaaagagaaaaacttc
acagttgagttcgcggtggagaagatacaccttggctggaagatctccggcagggtgaag
ggaagtccgggaaggcttgaggttcttcgaacgaaagcaccggaaaaggtacttgtgaac
aactggcagtcctggggaccgtgcagggtggtcgatgccttttctttcaaaccacctgaa
atagatccgaactggagatacaccgcttcggtggtgcccgatgtacttgaaaggaacctc
cagagcgactatttcgtggctgaagaaggaaaagtgtacggttttctgagttcgaaaatc
gcacatcctttcttcgctgtggaagatggggaacttgtggcatacctcgaatatttcgat
gtcgagttcgacgactttgttcctcttgaacctctcgttgtactcgaggatcccaacaca
ccccttcttctggagaaatacgcggaactcgtcggaatggaaaacaacgcgagagttcca
aaacacacacccactggatggtgcagctggtaccattacttccttgatctcacctgggaa
gagaccctcaagaacctgaagctcgcgaagaatttcccgttcgaggtcttccagatagac
gacgcctacgaaaaggacataggtgactggctcgtgacaagaggagactttccatcggtg
gaagagatggcaaaagttatagcggaaaacggtttcatcccgggcatatggaccgccccg
ttcagtgtttctgaaacctcggatgtattcaacgaacatccggactgggtagtgaaggaa
aacggagagccgaagatggcttacagaaactggaacaaaaagatatacgccctcgatctt
tcgaaagatgaggttctgaactggcttttcgatctcttctcatctctgagaaagatgggc
tacaggtacttcaagatcgactttctcttcgcgggtgccgttccaggagaaagaaaaaag
aacataacaccaattcaggcgttcagaaaagggattgagacgatcagaaaagcggtggga
gaagattctttcatcctcggatgcggctctccccttcttcccgcagtgggatgcgtcgac
gggatgaggataggacctgacactgcgccgttctggggagaacatatagaagacaacgga
gctcccgctgcaagatgggcgctgagaaacgccataacgaggtacttcatgcacgacagg
ttctggctgaacgaccccgactgtctgatactgagagaggagaaaacggatctcacacag
aaggaaaaggagctctactcgtacacgtgtggagtgctcgacaacatgatcatagaaagc
gatgatctctcgctcgtcagagatcatggaaaaaaggttctgaaagaaacgctcgaactc
ctcggtggaagaccacgggttcaaaacatcatgtcggaggatctgagatacgagatcgtc
tcgtctggcactctctcaggaaacgtcaagatcgtggtcgatctgaacagcagagagtac
cacctggaaaaagaaggaaagtcctccctgaaaaaaagagtcgtcaaaagagaagacgga
agaaacttctacttctacgaagagggtgagagagaatga

DBGET integrated database retrieval system