KEGG   Thermotoga maritima: TM1383Help
Entry
TM1383            CDS       T00022                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tma  Thermotoga maritima
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:tma00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1399118..1399933
Genome map
AA seq 271 aa AA seqDB search
MVENIGSGSAELVSYAKLNLYLDVLGKRSDGYHEIVGLFQTISLHDTLTVEICDRGFYLE
SSVALPSDNTIKRAWEMFRKNTGKEFGLKVTLKKEIPVGSGLGGGSSNAAAVLRYLGEVF
KIPLEDLLNIAAQVGSDVPFFLYGGTALVRGRGEIVEKLEDIEGYSVDLFFPGIHSSTKE
MYLSLTPEMYRKGPGRVEELHRAYLERNYEKIKELSYNVFEKVFLEKHPEVMDGLRNFGD
GSIVKMMTGSGSVFFALYPLDKGNYSFVGGV
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgaaaatatcggcagcggttctgctgaacttgtttcttacgcaaaactgaatctc
tacctggatgtgcttggaaaaagatccgacggatatcacgaaatagtgggattgtttcag
acgatttctcttcacgacacactaactgtggaaatctgtgatagaggtttctatctggaa
agcagcgtagctctgccctcggacaacacgatcaaaagagcctgggagatgttcaggaaa
aacacaggaaaagaattcggtctcaaagtcacgttgaaaaaggagatcccagtaggctct
ggcctcggtgggggaagctctaacgctgcagcggttctcagatatcttggtgaagttttc
aaaatacctcttgaagaccttctgaatatagcagctcaggtgggaagcgatgtacccttt
tttctttacggaggaaccgctcttgtgagaggaagaggagaaatcgtggagaaactcgag
gatatcgaaggatactctgttgatttgttcttcccgggcattcactcttcaacgaaagaa
atgtatctgtctctcacaccagagatgtacaggaaaggacccggcagggtagaggaactg
cacagggcttaccttgaaagaaattacgaaaagataaaggaactctcttacaacgtgttt
gagaaggtgttcttagagaaacacccggaggtaatggatggactgagaaactttggcgat
ggttccatagtgaaaatgatgacgggaagcggaagtgtctttttcgctctatatcctctg
gacaagggaaattactcgtttgtgggaggtgtttaa

DBGET integrated database retrieval system