KEGG   Thermotoga maritima: TM1430Help
Entry
TM1430            CDS       T00022                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tma  Thermotoga maritima
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TM1430
Enzymes [BR:tma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TM1430
Exosome [BR:tma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TM1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1446140..1447588
Genome map
AA seq 482 aa AA seqDB search
MKYVLSLDQGTTSSRAIVFDEKGNVVSKVNKEFRQIYPRPGWVEHDPVEIWESQIEVAKK
AIEEAGIKPEDIAAIGITNQRETTIVWDKNTGKPVYNAIVWQCRRTAPICDELKEKGYSE
FIRERTGLVIDAYFSGTKIKWILDNVEGVREKAEKGEVLFGTVDTWLIWNLTGGRVHVTD
YSNASRTMIFNIHKLDWDDEILELLNIPRAMLPQVMPSSHVYGYTAKDIFGVEIPIAGDA
GDQQAALFGQACFQPGMLKNTYGTGCFLLMNTGEKAFESKSGLLTTIAWGINGKVYYALE
GSIFITGAAVQWLRDGLKIISNAAETEELATKVPDNGGVFFVPAFVGLGAPYWDMYARGL
IIGITRGTTREHIVRAVLESIAYQTRDVVEVMEKDSDIKVETLRVDGGAVVNNFLMQFQA
DILGVPVERPVVNETTALGAAYLAGLAVGYWKDQEEIASLWQLDRRFEPSMNSEERERLY
SK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgttctctctctcgatcaaggtacaacaagctccagagcgatcgttttcgat
gaaaaaggaaacgtggtatcgaaagtcaacaaagaattcagacagatctatccaagaccg
gggtgggtagaacacgatcccgtggagatttgggaatcacagatcgaagtggcaaagaaa
gctatcgaagaagcagggataaaaccagaagacatcgccgcaataggtatcacaaaccag
agggaaacaaccatcgtctgggacaaaaacaccggaaaaccagtttacaacgccatagtc
tggcagtgtagaagaaccgctcccatctgtgatgagctgaaggaaaaaggatactcagag
ttcattcgagaaagaactggtcttgtcatcgatgcgtacttttctggaacaaagatcaag
tggattctcgacaacgtcgagggagtgagagaaaaggcagagaaaggagaagttctcttt
ggaacagttgacacctggctcatatggaatctcacaggtggaagggttcacgtcacggac
tattcgaacgcttccagaacgatgatcttcaatatccacaaactcgattgggacgatgaa
atcctggaacttctaaacataccgagggcaatgcttccacaggtgatgccgtcgagtcac
gtgtacggttacacagcaaaggatatcttcggagtggaaatacctatagctggagacgca
ggggatcaacaggcggcactgtttgggcaagcctgcttccagccaggcatgttgaaaaac
acttacggaacaggatgtttcctcctcatgaacaccggagaaaaagcctttgaatcgaaa
tccggtcttctcacaaccatcgcgtggggaataaacgggaaggtttactatgccctcgaa
ggcagcatattcatcactggcgccgctgtgcaatggctaagggacggtctgaagatcatc
tcaaacgccgcagaaaccgaagaactcgctacaaaagtgccggacaacggaggagtgttc
ttcgttcccgccttcgtcggactcggtgctccctactgggacatgtacgctcgaggtttg
atcataggcataaccagaggtaccaccagagagcatatagtgagggccgttcttgagtcg
atcgcctaccagacaagagacgtggtagaggtcatggaaaaagacagcgatataaaggtg
gaaaccctccgggtcgatggtggagccgttgtgaacaacttcctgatgcagtttcaggct
gacatactcggggttcctgtggagcgccccgttgtaaacgaaacgacggcacttggagct
gcttaccttgcagggctcgcagttgggtactggaaagatcaggaagagatagcttctctc
tggcaactcgacagaagatttgaaccttctatgaattccgaagaaagagagaggctgtat
tcaaaatga

DBGET integrated database retrieval system