KEGG   Thermotoga maritima: TM1430Help
Entry
TM1430            CDS       T00022                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tma  Thermotoga maritima
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tma00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1446140..1447588
Genome map
AA seq 482 aa AA seqDB search
MKYVLSLDQGTTSSRAIVFDEKGNVVSKVNKEFRQIYPRPGWVEHDPVEIWESQIEVAKK
AIEEAGIKPEDIAAIGITNQRETTIVWDKNTGKPVYNAIVWQCRRTAPICDELKEKGYSE
FIRERTGLVIDAYFSGTKIKWILDNVEGVREKAEKGEVLFGTVDTWLIWNLTGGRVHVTD
YSNASRTMIFNIHKLDWDDEILELLNIPRAMLPQVMPSSHVYGYTAKDIFGVEIPIAGDA
GDQQAALFGQACFQPGMLKNTYGTGCFLLMNTGEKAFESKSGLLTTIAWGINGKVYYALE
GSIFITGAAVQWLRDGLKIISNAAETEELATKVPDNGGVFFVPAFVGLGAPYWDMYARGL
IIGITRGTTREHIVRAVLESIAYQTRDVVEVMEKDSDIKVETLRVDGGAVVNNFLMQFQA
DILGVPVERPVVNETTALGAAYLAGLAVGYWKDQEEIASLWQLDRRFEPSMNSEERERLY
SK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgttctctctctcgatcaaggtacaacaagctccagagcgatcgttttcgat
gaaaaaggaaacgtggtatcgaaagtcaacaaagaattcagacagatctatccaagaccg
gggtgggtagaacacgatcccgtggagatttgggaatcacagatcgaagtggcaaagaaa
gctatcgaagaagcagggataaaaccagaagacatcgccgcaataggtatcacaaaccag
agggaaacaaccatcgtctgggacaaaaacaccggaaaaccagtttacaacgccatagtc
tggcagtgtagaagaaccgctcccatctgtgatgagctgaaggaaaaaggatactcagag
ttcattcgagaaagaactggtcttgtcatcgatgcgtacttttctggaacaaagatcaag
tggattctcgacaacgtcgagggagtgagagaaaaggcagagaaaggagaagttctcttt
ggaacagttgacacctggctcatatggaatctcacaggtggaagggttcacgtcacggac
tattcgaacgcttccagaacgatgatcttcaatatccacaaactcgattgggacgatgaa
atcctggaacttctaaacataccgagggcaatgcttccacaggtgatgccgtcgagtcac
gtgtacggttacacagcaaaggatatcttcggagtggaaatacctatagctggagacgca
ggggatcaacaggcggcactgtttgggcaagcctgcttccagccaggcatgttgaaaaac
acttacggaacaggatgtttcctcctcatgaacaccggagaaaaagcctttgaatcgaaa
tccggtcttctcacaaccatcgcgtggggaataaacgggaaggtttactatgccctcgaa
ggcagcatattcatcactggcgccgctgtgcaatggctaagggacggtctgaagatcatc
tcaaacgccgcagaaaccgaagaactcgctacaaaagtgccggacaacggaggagtgttc
ttcgttcccgccttcgtcggactcggtgctccctactgggacatgtacgctcgaggtttg
atcataggcataaccagaggtaccaccagagagcatatagtgagggccgttcttgagtcg
atcgcctaccagacaagagacgtggtagaggtcatggaaaaagacagcgatataaaggtg
gaaaccctccgggtcgatggtggagccgttgtgaacaacttcctgatgcagtttcaggct
gacatactcggggttcctgtggagcgccccgttgtaaacgaaacgacggcacttggagct
gcttaccttgcagggctcgcagttgggtactggaaagatcaggaagagatagcttctctc
tggcaactcgacagaagatttgaaccttctatgaattccgaagaaagagagaggctgtat
tcaaaatga

DBGET integrated database retrieval system