KEGG   Thermotoga maritima: TM1641Help
Entry
TM1641            CDS       T00022                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tma  Thermotoga maritima
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tma00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tma00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
1629572..1630090
Genome map
AA seq 172 aa AA seqDB search
MESVAKVIFVLAMDVSGKIASSVESWSSFEDRKNFRKITTEIGNVVMGRITFEEIGRPLP
ERLNVVLTRRPKTSNNPSLVFFNGSPADVVKFLEGKGYERVAVIGGKTVFTEFLREKLVD
ELFVTVEPYVFGKGIPFFDEFEGYFPLKLLEMRRLNERGTLFLKYSVEKSHR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtggcaaaagtgattttcgttcttgcgatggacgtctccggaaagatagcc
tcttctgttgagagctggagctcatttgaggacagaaaaaatttcagaaaaatcaccaca
gagatcggaaacgttgtgatgggaagaatcaccttcgaggaaataggaagacctcttcca
gagagactgaacgttgttttgacaagaagacccaaaacttccaacaatccttcactcgtt
tttttcaacggttcacccgcggatgtggtaaaattcctcgaaggaaaaggctacgaaagg
gtggctgtcataggaggaaagaccgtgttcacggaatttctgagagaaaaactggtagat
gagcttttcgtcactgtcgaaccgtacgtgttcggaaagggaataccttttttcgatgag
ttcgaaggttactttcctttgaaacttctggagatgaggcgtttgaacgaaagaggcaca
ctttttctcaaatattctgtagaaaaatcgcaccgttag

DBGET integrated database retrieval system