KEGG   Thermotoga maritima: TM1641Help
Entry
TM1641            CDS       T00022                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tma  Thermotoga maritima
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TM1641
   00670 One carbon pool by folate
    TM1641
Enzymes [BR:tma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TM1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1629572..1630090
Genome map
AA seq 172 aa AA seqDB search
MESVAKVIFVLAMDVSGKIASSVESWSSFEDRKNFRKITTEIGNVVMGRITFEEIGRPLP
ERLNVVLTRRPKTSNNPSLVFFNGSPADVVKFLEGKGYERVAVIGGKTVFTEFLREKLVD
ELFVTVEPYVFGKGIPFFDEFEGYFPLKLLEMRRLNERGTLFLKYSVEKSHR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtggcaaaagtgattttcgttcttgcgatggacgtctccggaaagatagcc
tcttctgttgagagctggagctcatttgaggacagaaaaaatttcagaaaaatcaccaca
gagatcggaaacgttgtgatgggaagaatcaccttcgaggaaataggaagacctcttcca
gagagactgaacgttgttttgacaagaagacccaaaacttccaacaatccttcactcgtt
tttttcaacggttcacccgcggatgtggtaaaattcctcgaaggaaaaggctacgaaagg
gtggctgtcataggaggaaagaccgtgttcacggaatttctgagagaaaaactggtagat
gagcttttcgtcactgtcgaaccgtacgtgttcggaaagggaataccttttttcgatgag
ttcgaaggttactttcctttgaaacttctggagatgaggcgtttgaacgaaagaggcaca
ctttttctcaaatattctgtagaaaaatcgcaccgttag

DBGET integrated database retrieval system