KEGG   Thermotoga maritima: TM1642Help
Entry
TM1642            CDS       T00022                                 

Gene name
pyrB
Definition
bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit (EC:2.1.3.2)
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
tma  Thermotoga maritima
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tma00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tma00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1630126..1631709
Genome map
AA seq 527 aa AA seqDB search
MKRDFLGRTLAVIEDLSVEEQMFLYEKTRELKQRWYSGEDVSDFRIKKRNVGIYIVFVEP
STRTKESFINAAKFHSGPNVKVNVFDSEHSSFNKQESYTDTFSMLTGYSDYSIFVVRTRL
EGVCRLLERRISEFASRNGIEVPSFINAGDGKHEHPTQELLDEYTFLEQNGFDNSFIHVA
LVGDLLHGRTVHSKVNGLKIFKNVKVDLVAPEELMMPEHYVEKMKKNGFEVRIFSSIREY
LDQKDVAKIWYFTRLQLERMGEDILEKVHVLREAVTFKKEYLDALPEGVKFYHPLPRHKV
YPTIPNFLDTLPLNGWETQARNGYWVRIVLLSMFGGALEAPFDTSKKEEKPEEDFIIPAP
ITHGSKGVQKEGKRGIKPIENGTVIDHIAKGKTPEEIYSTILKIRKILRLYDVDSADGIF
RSSDGSFKGYISLPDRYLSKKEIKKLSAISPNTTVNIIKNSTVVEKYRIKLPPTIYGFEE
LRCKNENCITNPAHGENASPSFVRNEKGQFICEYCETPHSFEEIWSI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggattttctcggcagaaccctcgcagtcatagaagatctgagcgtggaggag
cagatgttcctctatgaaaaaaccagggagctcaaacagagatggtacagcggagaggat
gtatcggatttcaggataaagaagagaaacgttggaatatacatcgttttcgttgaacca
agcacgaggacgaaagaatccttcataaacgccgcgaagtttcactcgggcccgaacgtg
aaggtgaacgttttcgattcggaacattcctctttcaacaaacaggagagctacacggac
accttctccatgctcacaggctacagcgactactccatattcgttgtgagaacaagactc
gagggagtctgcagactcctggaaagaagaatatcagagttcgcaagcaggaacggtata
gaagtaccctcttttataaacgcgggtgacggaaagcacgagcatccaacacaggaactt
ctggatgaatacacctttctcgagcagaacggttttgacaactcgttcatacatgtggca
ctcgttggtgacctgcttcacggccgaacggttcattctaaagtgaacggcttgaagata
ttcaaaaatgtgaaggtggatcttgtggcaccggaagaactcatgatgcctgagcattac
gtagagaagatgaaaaagaacggttttgaggtcaggattttctcttcgatcagagagtat
ctcgaccagaaagatgtggcaaagatctggtactttacacggcttcaactcgaaagaatg
ggagaagacattctcgagaaggttcatgttctgagagaagcagtcactttcaaaaaagag
tatctggacgcactgccggaaggagtgaagttctatcatccgcttccaaggcacaaggtt
tatccgacgataccgaactttctggacacacttcctctgaacggatgggaaacacaggct
aggaacggttactgggtgaggatcgtgcttctttccatgtttggtggagcgctggaagca
cctttcgatacctcgaagaaagaagaaaaaccagaagaagacttcataatccccgctccc
atcacacacggatcaaagggggttcaaaaggaaggaaagagaggcataaaacccatcgaa
aacggaacggtgatagaccacatagccaagggaaagacaccggaggaaatctactcaaca
attttgaaaataaggaaaattctgagactctacgatgtggacagtgcggatggtattttc
cggtcgagcgatggaagcttcaagggttacatcagcctgccggatcgttatctctccaag
aaagaaataaagaaactctcggcgatttctccgaacaccacggtcaacatcataaaaaac
agcacggttgttgaaaagtacagaataaagcttccaccaacgatctatggattcgaagag
ctccgatgcaaaaacgagaactgtatcaccaatcccgcacacggtgaaaatgcttcacct
tcctttgtgagaaacgaaaaaggacagttcatatgcgagtactgtgaaacaccgcattct
ttcgaagagatctggagtatttga

DBGET integrated database retrieval system