KEGG   Thermotoga maritima MSB8: TM1642Help
Entry
TM1642            CDS       T00022                                 

Gene name
pyrB
Definition
(RefSeq) bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit
  KO
K00608  aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00240  Pyrimidine metabolism
tma00250  Alanine, aspartate and glutamate metabolism
tma01100  Metabolic pathways
Module
tma_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TM1642 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TM1642 (pyrB)
Enzymes [BR:tma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TM1642 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N PyrI PyrI_C OTCace DUF960
Motif
Other DBs
NCBI-GeneID: 897920
NCBI-ProteinID: NP_229442
UniProt: P96111 G4FG31
Position
1630126..1631709
Genome map
AA seq 527 aa AA seqDB search
MKRDFLGRTLAVIEDLSVEEQMFLYEKTRELKQRWYSGEDVSDFRIKKRNVGIYIVFVEP
STRTKESFINAAKFHSGPNVKVNVFDSEHSSFNKQESYTDTFSMLTGYSDYSIFVVRTRL
EGVCRLLERRISEFASRNGIEVPSFINAGDGKHEHPTQELLDEYTFLEQNGFDNSFIHVA
LVGDLLHGRTVHSKVNGLKIFKNVKVDLVAPEELMMPEHYVEKMKKNGFEVRIFSSIREY
LDQKDVAKIWYFTRLQLERMGEDILEKVHVLREAVTFKKEYLDALPEGVKFYHPLPRHKV
YPTIPNFLDTLPLNGWETQARNGYWVRIVLLSMFGGALEAPFDTSKKEEKPEEDFIIPAP
ITHGSKGVQKEGKRGIKPIENGTVIDHIAKGKTPEEIYSTILKIRKILRLYDVDSADGIF
RSSDGSFKGYISLPDRYLSKKEIKKLSAISPNTTVNIIKNSTVVEKYRIKLPPTIYGFEE
LRCKNENCITNPAHGENASPSFVRNEKGQFICEYCETPHSFEEIWSI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggattttctcggcagaaccctcgcagtcatagaagatctgagcgtggaggag
cagatgttcctctatgaaaaaaccagggagctcaaacagagatggtacagcggagaggat
gtatcggatttcaggataaagaagagaaacgttggaatatacatcgttttcgttgaacca
agcacgaggacgaaagaatccttcataaacgccgcgaagtttcactcgggcccgaacgtg
aaggtgaacgttttcgattcggaacattcctctttcaacaaacaggagagctacacggac
accttctccatgctcacaggctacagcgactactccatattcgttgtgagaacaagactc
gagggagtctgcagactcctggaaagaagaatatcagagttcgcaagcaggaacggtata
gaagtaccctcttttataaacgcgggtgacggaaagcacgagcatccaacacaggaactt
ctggatgaatacacctttctcgagcagaacggttttgacaactcgttcatacatgtggca
ctcgttggtgacctgcttcacggccgaacggttcattctaaagtgaacggcttgaagata
ttcaaaaatgtgaaggtggatcttgtggcaccggaagaactcatgatgcctgagcattac
gtagagaagatgaaaaagaacggttttgaggtcaggattttctcttcgatcagagagtat
ctcgaccagaaagatgtggcaaagatctggtactttacacggcttcaactcgaaagaatg
ggagaagacattctcgagaaggttcatgttctgagagaagcagtcactttcaaaaaagag
tatctggacgcactgccggaaggagtgaagttctatcatccgcttccaaggcacaaggtt
tatccgacgataccgaactttctggacacacttcctctgaacggatgggaaacacaggct
aggaacggttactgggtgaggatcgtgcttctttccatgtttggtggagcgctggaagca
cctttcgatacctcgaagaaagaagaaaaaccagaagaagacttcataatccccgctccc
atcacacacggatcaaagggggttcaaaaggaaggaaagagaggcataaaacccatcgaa
aacggaacggtgatagaccacatagccaagggaaagacaccggaggaaatctactcaaca
attttgaaaataaggaaaattctgagactctacgatgtggacagtgcggatggtattttc
cggtcgagcgatggaagcttcaagggttacatcagcctgccggatcgttatctctccaag
aaagaaataaagaaactctcggcgatttctccgaacaccacggtcaacatcataaaaaac
agcacggttgttgaaaagtacagaataaagcttccaccaacgatctatggattcgaagag
ctccgatgcaaaaacgagaactgtatcaccaatcccgcacacggtgaaaatgcttcacct
tcctttgtgagaaacgaaaaaggacagttcatatgcgagtactgtgaaacaccgcattct
ttcgaagagatctggagtatttga

DBGET integrated database retrieval system