KEGG   Thermotoga maritima MSB8: TM1666Help
Entry
TM1666            CDS       T00022                                 

Definition
(RefSeq) diaminopimelate aminotransferase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tma  Thermotoga maritima MSB8
Pathway
tma00300  Lysine biosynthesis
tma01100  Metabolic pathways
tma01120  Microbial metabolism in diverse environments
tma01230  Biosynthesis of amino acids
Module
tma_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TM1666
Enzymes [BR:tma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TM1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 SpoOE-like
Motif
Other DBs
NCBI-GeneID: 896862
NCBI-ProteinID: NP_229466
UniProt: R4P1J1 Q9X1Z4
Position
complement(1652165..1653355)
Genome map
AA seq 396 aa AA seqDB search
MEITKRIEELREEMVESLKKFISINSVNPAFGGPGEKEKADWLEGLLRDFGFEVDRCDVR
DDRGIWRSNIVAKIPGKNREKTLWIVTHIDTVPPGDLSLWETDPFVPVVKDGKVYGRGAE
DNGGSMIASIYAGKALIDLGITPEYNFGLALVADEEAGSEYGIQYLIEKGLFSPEDMFLV
PDAGNEKGDFIEIAEKSILWFKVMVNGKQGHASRPQTTENALRKGAHLITEIDEALHRKY
SDRDELFDEPLSTFEPTRAEKTVDNVNTVPGRFVFYFDCRVLPRYNLDEVLSIVKSILDG
RGAELEVVVKQPAPEPTPPDSELVVKLSNVLRSLRGLEAKVGGIGGGTCAAFFRKKGWPA
VVWSTIDETAHQPNEYRRISHMVEDAKVFALLGTER
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggagatcacaaaaagaatagaagagctcagagaggaaatggtggaatccttgaagaaa
ttcatctccatcaactcggtgaatcctgcttttggaggcccgggagagaaagaaaaggcc
gactggcttgaaggcctcctcagggatttcggtttcgaggtcgaccgctgcgatgtgaga
gacgataggggtatatggcgatcgaacattgtggcaaagattccgggaaaaaatagagaa
aaaacgctctggatcgtgactcacatcgacacggtaccaccgggagatctctctttgtgg
gagacggatcctttcgtgcccgttgtgaaggacgggaaagtttacggtaggggagccgaa
gacaacggaggttccatgatagcctccatatacgctgggaaggcccttatcgaccttggt
atcactcccgagtacaacttcggtcttgcactcgttgccgatgaggaggcgggaagtgag
tatggaatccaatatctgatagaaaaagggttgttcagcccagaagacatgttcctggtc
ccggatgctggaaacgaaaagggagacttcatcgagatcgcagagaagagcatcctgtgg
ttcaaagtgatggtgaacggaaaacagggacacgcttcaagaccgcaaacaacagagaac
gctctcagaaagggtgcacatctcataacagagatagatgaagcactccacaggaaatac
tccgatagagatgaactcttcgatgaaccgctcagcacgttcgagcccactcgcgctgaa
aaaactgtggacaacgtgaacaccgttcccggcagattcgtcttttacttcgactgcagg
gtcctgcctcgctacaatctcgacgaggtgctgtccatcgtcaagtcgattctcgatgga
agaggtgcagagctggaggtcgtcgtgaaacagcccgcgcccgagccaactccacccgat
tcggaactcgtggtgaaactttccaatgttttgagaagtctaagagggctggaagcgaaa
gtgggaggtataggtggaggcacctgcgctgcgttcttcagaaagaaaggctggcccgcg
gtcgtctggagcacaatagacgagactgctcatcagcccaacgagtaccgaaggatatcg
cacatggtggaagatgcgaaggtgttcgcacttctcggaaccgagaggtga

DBGET integrated database retrieval system