KEGG   Thermotoga maritima: TM1667Help
Entry
TM1667            CDS       T00022                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tma  Thermotoga maritima
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TM1667
   00051 Fructose and mannose metabolism
    TM1667
Enzymes [BR:tma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     TM1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1653460..1654794
Genome map
AA seq 444 aa AA seqDB search
MAEFFPEIPKIQFEGKESTNPLAFRFYDPNEVIDGKPLKDHLKFSVAFWHTFVNEGRDPF
GDPTAERPWNRFSDPMDKAFARVDALFEFCEKLNIEYFCFHDRDIAPEGKTLRETNKILD
KVVERIKERMKDSNVKLLWGTANLFSHPRYMHGAATTCSADVFAYAAAQVKKALEITKEL
GGEGYVFWGGREGYETLLNTDLGLELENLARFLRMAVEYAKKIGFTGQFLIEPKPKEPTK
HQYDFDVATAYAFLKNHGLDEYFKFNIEANHATLAGHTFQHELRMARILGKLGSIDANQG
DLLLGWDTDQFPTNIYDTTLAMYEVIKAGGFTKGGLNFDAKVRRASYKVEDLFIGHIAGM
DTFALGFKIAYKLAKDGVFDKFIEEKYRSFKEGIGKEIVEGKTDFEKLEEYIIDKEDIEL
PSGKQEYLESLLNSYIVKTIAELR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatttttcccagaaatcccaaagattcagtttgaaggtaaggaaagcacgaac
ccgctggcgttcaggttctacgatccgaacgaggtgatcgatgggaagcccctcaaggat
catctgaagttttccgtcgccttctggcacactttcgtgaacgagggaagagatccgttt
ggagatccaaccgctgaacgcccatggaacaggttctccgatcccatggacaaagctttt
gcaagggtggacgctctcttcgagttctgcgaaaagctcaacatcgagtacttctgtttc
cacgacagagacatcgctcccgaaggaaagacgctcagagagacaaacaagatactggac
aaagtggtggaaagaattaaggaaagaatgaaggacagcaacgtgaaactcctctgggga
acggcgaatctgttctcccacccgaggtacatgcacggcgccgcgacgacatgcagtgcg
gatgtctttgcctacgcggcggcccaggtgaagaaggccctcgagatcacaaaagaacta
ggaggagaaggctacgtcttctggggtggaagagaaggctatgaaacactcctcaacaca
gatctcgggctggaactcgaaaatctcgcgagatttctcagaatggcagtggagtacgca
aagaagatcggcttcaccggacagttcctcatagaacccaagccgaaagaacccaccaag
caccagtacgatttcgatgtggcaacggcctacgctttcctgaagaaccacggccttgat
gagtacttcaagttcaacattgaagcgaaccacgcgacacttgccggtcacacattccag
cacgaactgaggatggcaaggatcctcggaaaacttggaagcatcgacgccaaccaggga
gatctcctgctcggctgggacaccgaccagttcccaacgaacatctacgacacaacactt
gccatgtacgaagtgataaaagcaggaggattcacaaagggtggcctcaacttcgacgcg
aaggtgaggagggcttcctacaaggtagaagatctcttcatcggtcacatcgcaggaatg
gacaccttcgccctcggcttcaagatagcgtacaaactcgcgaaagacggagtgttcgac
aagttcatcgaggaaaaatacagaagcttcaaagaaggtatcggaaaagagatcgtagaa
ggaaaaaccgatttcgaaaaactcgaagagtatataatagacaaagaagatatcgaactt
ccatctggaaagcaggagtacctcgaaagcctgctcaacagctacatagtgaagacaata
gcagaactgaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system