KEGG   Thioflavicoccus mobilis: Thimo_0241Help
Entry
Thimo_0241        CDS       T02397                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thimo_0241
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thimo_0241
   00640 Propanoate metabolism
    Thimo_0241
   00660 C5-Branched dibasic acid metabolism
    Thimo_0241
Enzymes [BR:tmb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Thimo_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
257721..258881
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQAKELLRKYGVITPRGVPCFSVDEAVKAAESLGGKVWVVKAQIHAGGRGKGGGV
KVAKSLDEVRQYAGQILGMQLVTHQTGPEGQEVKRLLVEEGADIASELYVGMVVDRVTQR
VCLMASSEGGMDIEEVAAKTPEKIHKVFIDPAAGLTAQEADDTAAKIGVPTASIPQARAV
LQGLYSAFWDSDASLAEINPLIVTGDGQVIALDAKMNFDSNGLFRHEDILAMRDLDEEDA
AEIEASKYDLSYISLDGNIGCMVNGAGLAMATMDTIKLFGAEPANFLDVGGGATVEKVTE
AFKLMLANTKVKAILVNIFGGIMRCDTIADGIVEAAKQTHLSVPLVVRMRGTNEEIGKKT
LEASGLPIITANDMAEAAQKVVAAVA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtatcaggccaaggagctcctgcgcaaatacggagtcatcacgccg
cgcggcgtcccctgcttctccgtcgacgaggcggtcaaggccgccgaatccctcggcggg
aaggtctgggtggtcaaggcccagatccatgctggcggtcgtggcaagggcggcggggtg
aaggtggccaagtcgctggacgaggtgcgccagtacgccgggcagatcctcggcatgcag
ttggtgactcaccagaccggccccgagggccaagaggtcaagcgcctgctggtcgaagag
ggcgccgatatcgcctccgaactctatgtcggcatggtggtcgaccgtgtcacccagcgg
gtgtgcctgatggcctccagcgagggtggcatggacatcgaagaggtggccgccaagacc
ccggagaagatacacaaggtgttcatcgatcccgccgcgggcctgaccgctcaggaggcc
gacgacaccgctgccaagatcggcgtgccgacggccagcataccccaggcccgcgccgtg
ttgcaggggctctatagcgccttctgggacagcgacgcctcgctcgccgagatcaatccg
ctgatcgtcaccggcgacggccaggtcatcgccctggacgccaagatgaacttcgattcc
aacggtctgttccgccacgaggacatcctcgccatgcgcgacctggacgaagaggacgcg
gcggagatcgaggcctccaagtacgacctctcctacatctcgctggacggcaatatcggc
tgcatggtcaatggtgcaggcctagccatggccacgatggacaccatcaagctgttcggc
gccgaaccggccaatttcctcgacgtgggcggtggtgccaccgtggagaaggtcaccgag
gccttcaagctgatgctggccaacaccaaggtcaaggcgattctcgtcaacatcttcggt
ggcatcatgcgctgcgacaccatcgccgacggcatcgtcgaggcggccaagcagacccat
ctctcggtgcccctggtggtgcgcatgcgcggcaccaacgaggagatcggcaagaagacc
ctcgaggcgtccggactgccgatcatcaccgccaacgatatggccgaggccgcccagaag
gtcgtggccgctgtcgcctga

DBGET integrated database retrieval system