KEGG   Thioflavicoccus mobilis: Thimo_0465Help
Entry
Thimo_0465        CDS       T02397                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00020  Citrate cycle (TCA cycle)
tmb00190  Oxidative phosphorylation
tmb00650  Butanoate metabolism
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01120  Microbial metabolism in diverse environments
tmb01130  Biosynthesis of antibiotics
tmb01200  Carbon metabolism
Module
tmb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tmb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thimo_0465
   00650 Butanoate metabolism
    Thimo_0465
  Energy metabolism
   00190 Oxidative phosphorylation
    Thimo_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AGA89323
UniProt: L0GRD9
Position
500920..501264
Genome map
AA seq 114 aa AA seqDB search
MSRQASGLKAWLVQRVTALYLAVFSIYLLVHFLVAPPADYGAWRAWVAQPLVSLGLLVTV
PVLLAHAWVGLRDILMDYVKSLGLRVGLLSAAAFVFLAAGLWALRSIILVGLQG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccaagcctcgggcctcaaggcctggctcgtgcagcgcgtcacggctctctat
ctcgctgtcttctccatctacctgctggtccacttcctcgtcgcgccgccggccgactat
ggcgcctggcgcgcctgggtcgcgcagccgctggtcagcctcgggttgctcgtcacggtg
ccggtcctgttggcccacgcctgggtcggcctgcgcgatatcctgatggactacgtcaag
tccctcgggctgcgtgtcggcctgctctccgccgctgccttcgtcttcctcgccgccggt
ctctgggcgctgcgctcgatcatcctcgtcggcctacaggggtga

DBGET integrated database retrieval system