KEGG   Thioflavicoccus mobilis: Thimo_0681Help
Entry
Thimo_0681        CDS       T02397                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thimo_0681
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thimo_0681
  Amino acid metabolism
   00310 Lysine degradation
    Thimo_0681
Enzymes [BR:tmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Thimo_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740454..741728
Genome map
AA seq 424 aa AA seqDB search
MTTEVRVPNLPESVADATVLAWHKEPGAAVRRGENLVDLETDKVVLEVPAPVDGVLTEIE
AQKGDVVSADAVLARIEAGAATDEGAVSAREAPAAPPASEPASRRAPTPRQASSTPAHPA
TAPAEPVLAPAARRMVKEMALDPAEIAGSGRGGRIHKADVVAFLDRSESSAPDVDQETGM
SPPAAGLGGEAGRPEQRVPMTRLRARIAERLVEAQQTAAILTTFNEVNLQAVMDLRRRYK
DRFEQAHGVRLGFMSFFVKAAVEALQRFPMVNASVDENDIIYHGYYDIGIAVSSPRGLVV
PILRDCDQLSMADIELAIAEFAGKAKDGSLSYEDLTGGTFSITNGGVFGSLLSTPILNPP
QSAILGMHKVQERPVVEDGAILVRPMMYLALSYDHRLIDGRDAVQFLVAIKEAIEDPARL
LLRV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaagtccgtgtccccaacctcccggaatccgtcgccgacgccaccgtgctc
gcttggcacaaggagcccggtgcggcggtgcgccggggcgagaatctcgtagatctggag
acagacaaggtggtgctggaggtgccggcgccagtcgacggggtactgaccgagatcgag
gcgcagaagggcgatgtggtctcggccgacgcggtgctggcgcggatcgaggcgggcgca
gcgacggacgagggcgccgtctctgcccgggaggcacccgcggcaccgcccgcgtcggaa
ccggcatcgcgtcgtgccccgacgccccgtcaggcgtcgagcacgcccgctcacccggcg
acggcaccggccgaacccgtgctcgccccggccgcgcggcgcatggtcaaggagatggcg
ctcgacccggccgagatcgccggcagcgggcgcggtgggcgtatccacaaggccgacgtg
gtcgcctttctcgaccgcagtgagtcgagcgcgccggatgtcgatcaggagaccggcatg
tcgcccccggcggccggcctcggcggcgaggccggccgtcccgagcaacgcgtgccgatg
acccggctgcgtgcccgcatcgccgagcgcctggtcgaggcccagcagacggcggcgatc
ctgacgaccttcaacgaggtcaacctacaagcggtcatggatctgcgacggcgctacaag
gaccgcttcgagcaggctcatggcgtgcgcctcgggttcatgtctttcttcgtcaaggcc
gccgtcgaggcgctgcaacgtttcccgatggtcaacgcctcggtcgacgagaacgacatc
atctaccacggctactacgacatcggcatcgccgtcagttcgccgcgagggctggtcgtg
ccgatcctgcgcgactgtgaccaattgtcgatggccgacatcgagctcgcgatcgccgag
ttcgccggcaaggccaaggacggttcgctgagttacgaagacctgaccgggggcaccttc
tcgatcaccaatggcggggtgttcggctcgctgctctcgacgccgatcctgaacccgccg
cagagtgccattctggggatgcacaaggtccaggagcgcccggtcgtcgaggatggcgcc
atcctggtgcgcccgatgatgtatctcgccctatcctacgatcaccggctcatcgatgga
cgtgacgccgtgcaattcctggttgcgatcaaagaggcgatcgaggatccggcgcggttg
ttgctcagggtgtga

DBGET integrated database retrieval system