KEGG   Thioflavicoccus mobilis: Thimo_0681Help
Entry
Thimo_0681        CDS       T02397                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00020  Citrate cycle (TCA cycle)
tmb00310  Lysine degradation
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01120  Microbial metabolism in diverse environments
tmb01130  Biosynthesis of antibiotics
tmb01200  Carbon metabolism
Module
tmb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thimo_0681
  Amino acid metabolism
   00310 Lysine degradation
    Thimo_0681
Enzymes [BR:tmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Thimo_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 Biotin_lipoyl_2 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AGA89520
UniProt: L0GVY3
Position
740454..741728
Genome map
AA seq 424 aa AA seqDB search
MTTEVRVPNLPESVADATVLAWHKEPGAAVRRGENLVDLETDKVVLEVPAPVDGVLTEIE
AQKGDVVSADAVLARIEAGAATDEGAVSAREAPAAPPASEPASRRAPTPRQASSTPAHPA
TAPAEPVLAPAARRMVKEMALDPAEIAGSGRGGRIHKADVVAFLDRSESSAPDVDQETGM
SPPAAGLGGEAGRPEQRVPMTRLRARIAERLVEAQQTAAILTTFNEVNLQAVMDLRRRYK
DRFEQAHGVRLGFMSFFVKAAVEALQRFPMVNASVDENDIIYHGYYDIGIAVSSPRGLVV
PILRDCDQLSMADIELAIAEFAGKAKDGSLSYEDLTGGTFSITNGGVFGSLLSTPILNPP
QSAILGMHKVQERPVVEDGAILVRPMMYLALSYDHRLIDGRDAVQFLVAIKEAIEDPARL
LLRV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaagtccgtgtccccaacctcccggaatccgtcgccgacgccaccgtgctc
gcttggcacaaggagcccggtgcggcggtgcgccggggcgagaatctcgtagatctggag
acagacaaggtggtgctggaggtgccggcgccagtcgacggggtactgaccgagatcgag
gcgcagaagggcgatgtggtctcggccgacgcggtgctggcgcggatcgaggcgggcgca
gcgacggacgagggcgccgtctctgcccgggaggcacccgcggcaccgcccgcgtcggaa
ccggcatcgcgtcgtgccccgacgccccgtcaggcgtcgagcacgcccgctcacccggcg
acggcaccggccgaacccgtgctcgccccggccgcgcggcgcatggtcaaggagatggcg
ctcgacccggccgagatcgccggcagcgggcgcggtgggcgtatccacaaggccgacgtg
gtcgcctttctcgaccgcagtgagtcgagcgcgccggatgtcgatcaggagaccggcatg
tcgcccccggcggccggcctcggcggcgaggccggccgtcccgagcaacgcgtgccgatg
acccggctgcgtgcccgcatcgccgagcgcctggtcgaggcccagcagacggcggcgatc
ctgacgaccttcaacgaggtcaacctacaagcggtcatggatctgcgacggcgctacaag
gaccgcttcgagcaggctcatggcgtgcgcctcgggttcatgtctttcttcgtcaaggcc
gccgtcgaggcgctgcaacgtttcccgatggtcaacgcctcggtcgacgagaacgacatc
atctaccacggctactacgacatcggcatcgccgtcagttcgccgcgagggctggtcgtg
ccgatcctgcgcgactgtgaccaattgtcgatggccgacatcgagctcgcgatcgccgag
ttcgccggcaaggccaaggacggttcgctgagttacgaagacctgaccgggggcaccttc
tcgatcaccaatggcggggtgttcggctcgctgctctcgacgccgatcctgaacccgccg
cagagtgccattctggggatgcacaaggtccaggagcgcccggtcgtcgaggatggcgcc
atcctggtgcgcccgatgatgtatctcgccctatcctacgatcaccggctcatcgatgga
cgtgacgccgtgcaattcctggttgcgatcaaagaggcgatcgaggatccggcgcggttg
ttgctcagggtgtga

DBGET integrated database retrieval system