KEGG   Thioflavicoccus mobilis: Thimo_0725Help
Entry
Thimo_0725        CDS       T02397                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00900  Terpenoid backbone biosynthesis
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01130  Biosynthesis of antibiotics
Module
tmb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thimo_0725
Enzymes [BR:tmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Thimo_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGA89564
UniProt: L0GW92
Position
790374..791564
Genome map
AA seq 396 aa AA seqDB search
MIGITVLGSTGSIGVSTLDVIARHPERFRVVALTANRDAQGLAQQCRRFAPAYAVMVDPQ
AAAQLRDLLADMAEPPEVLTGAAALELVAALPEVGVVMAAVVGAAGMMPTLAAARAGKRV
LLANKEALVVAGALLMRAVADNNALLLPIDSEHNAIFQCLPPNYADGLEAVGVERILLTA
SGGPFRDADPRTLAGVTPEQACAHPNWAMGRKISVDSATMMNKGLELIEACWLFGTSPER
IQVVVHPQSVIHSLVQYVDGSVLAELGNPDMRTPIGHALAWPERMTSGVAPLDLFAVARL
DFQPPDLERFPCLRLAYEAAAAGGTAPAVLNAANEVAVAAFLERRIGFTDIPRVVGETLA
AVPGVTIEEGQGVELLLAVDREARAAAERRVDVLAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggcatcacggtactcggttcgacgggttcgatcggggtcagcaccctggatgtg
atcgcccgccaccccgagcgattccgcgtcgtcgccctgaccgccaaccgcgatgcgcag
gggctcgcgcagcagtgtcggcgtttcgccccggcctatgcggtcatggtcgatccgcag
gctgccgcgcaactgcgcgatctgctggccgatatggccgagccgcccgaggtgctgacc
ggtgcggcggcgctggagctggtcgcggcactgcccgaggtcggtgtcgtgatggcggcc
gtcgtcggtgccgccggcatgatgccgacgctggcggcggcgcgggccggcaagcgggtt
ctgcttgccaacaaagaggccctggtcgtggccggcgccttgctgatgcgggccgtggcc
gacaacaacgccctgttgctgccgatcgacagcgaacacaatgcgatcttccagtgcctg
ccgcccaactacgccgatggcctcgaggccgtcggcgtcgagcgcatcctgctgaccgca
tccggtgggccgttccgcgatgccgatccgcgcaccctcgcgggcgtgacgcccgagcag
gcctgcgcccatccgaactgggcgatgggccgcaagatttcggtcgattcggcgaccatg
atgaacaaggggctcgagttgatcgaggcctgctggctgttcggcacctccccggaacgc
atccaggtcgtcgtccacccgcagagcgtcatccattcgctggtgcaatatgtggacggc
tcggtgctcgccgaactcggcaatccggatatgcgcacgccgatcggccatgccttggct
tggccggaacggatgacctcgggggtcgcgccgctcgatctcttcgccgtggcgcggctc
gatttccagccgccggatctggagcgcttcccctgtctgcggctggcctacgaggcggct
gcggccggtggtacggcgccagcggtgctcaacgccgctaacgaggtcgccgttgccgcc
ttcctcgagcggcgcattggtttcaccgatattccccgggtcgttggcgagacgcttgcg
gcggtgcccggggtcacgatcgaggaggggcagggcgtcgagctgctgctcgccgtcgat
cgcgaggcacgcgctgccgctgagcgtcgggtcgacgtcctggcggcctga

DBGET integrated database retrieval system