KEGG   Thioflavicoccus mobilis: Thimo_1054Help
Entry
Thimo_1054        CDS       T02397                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tmb01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tmb00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tmb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1139937..1142114)
Genome map
AA seq 725 aa AA seqDB search
MTERVTTGGLRVAQPLYDLITDEIAPGTGIDPGHFFAQLDEIVRDLAPRNRALLEVRDAM
QAQLDTWHRTHRGQTHDVDAYRAFLAEIGYLVPEGEGFTVTTANVDPEIARIAGPQLVVP
VSNPRYALNAANARWGSLYDALYGSDVVPEEDGCERRADYNPRRGAAVVAYANRLLDEAA
PLVRGSHADAAGYRIETGQLIVQLPDNSTTSLADPDRLAGYQGPAEAPSAVLLVHHGLHI
EIQIDRTHPIGQASVAGVKDLVLESAVTTIQDFEDSVAAVDTADKVAVYRNWLGLMRGDL
SAEFSKGGCMMTRTLEPDRRYTRPDGGELRLPGRSLMLVRNVGHLMTTDAVLTADGEEIP
EGILDGMVAAFAALHDLQGLGRYRNSAAGSLYIVKPKMHGPDEVAFTVELFARIEAALGL
EGNRLKVGIMDEERRTTLNLEACIRAARERVIFINTGFLDRTGDEIHSVMEAGPVYRKGD
MKSAPWLLAYEDWNVDLGLACGLPGHAQIGKGMWTMPDRMQGMVATKQAHPQAGASCAWV
PSPTAATLHALHYHQVDVAARQREIAAGGRRARLETLLEIPVVTAPDWNPEEIQAELDNN
CQGILGYVVRWIDQGVGCSKVPDIADVGLMEDRATLRISSQHVANWLYHGVVTEAQVMET
LRRMAAIVDGQNADDPFYRPMAPGFDGLAFQAARDLIFNGRNVPNGYTEPTLHARRRARK
TQLKR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcgtcaccaccggcggcctgcgcgtcgcccaacctctctacgacctcatc
accgacgagatcgcccctggcacgggcatcgaccccgggcacttcttcgcccagctcgac
gagatcgtccgcgacctggcgccgcgcaaccgcgcgctcctagaggtgcgcgacgccatg
caggcgcaactcgacacctggcatcgcacccatcgcggccaaacgcacgacgtcgatgcc
taccgcgccttcctcgccgagatcggctacctggtcccggagggcgaggggttcacggtg
acgaccgccaacgtcgaccccgagatcgcccggatcgccggtccacagctcgtcgtgccc
gtcagcaacccacgctatgccctgaacgccgccaacgcacgctggggcagcctctacgac
gccctctacggcagcgacgtggtcccggaggaagacggctgcgagcgccgcgccgactac
aacccgcgccgcggcgcggcggtcgtcgcctacgccaaccgcctcctcgacgaggccgca
ccgctggtgcgcggttcccacgccgacgccgccggctaccggatcgagacaggccaactc
atcgtccaactgccggacaacagcaccacctcgctcgccgacccggaccggctggccggc
taccagggcccggccgaggcgccgagcgcggtcctgctcgtccaccacggcctgcacatc
gagatccagatcgaccgcacccacccgatcggccaggcgagcgtcgcgggcgtcaaggac
ctggtgttggaatcggccgtcacgaccatccaggacttcgaggactcggtcgcagccgtt
gataccgccgacaaggtcgccgtctaccgcaactggctcgggctgatgaggggggatttg
agcgccgagttcagcaagggcggatgcatgatgacgcgcacgctggaaccggaccgccgc
tatacgcggcccgacggcggcgaactgcggctgccgggccgctcgctgatgctggtgcgc
aacgtcggccacctgatgacgaccgatgcggtcttgaccgccgacggcgaggagatcccc
gaggggatcctcgacggcatggtcgccgccttcgccgccctgcacgacttgcagggcctc
ggccgctaccgcaactcggcggcgggcagcctctacatcgtcaagccgaagatgcacggc
cccgacgaggttgccttcacggtcgagctcttcgcgcgcatcgaagcggcgctcgggctc
gagggcaacaggctcaaggtcggcatcatggacgaagagcggcgcacgacgctgaacctc
gaggcctgcatccgtgccgcccgcgagcgggtgatcttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccattcggtcatggaggccggcccggtctaccgcaagggcgac
atgaagtcggccccctggctcctcgcctacgaggactggaacgtcgatctcggcctcgcc
tgcggactgccgggccatgcccagatcggcaagggcatgtggacgatgcccgatcgcatg
caggggatggtcgcgaccaagcaggcccacccgcaggccggcgcgagctgcgcctgggtg
ccctcgccgaccgccgcgaccctgcacgccctgcactaccaccaagtcgacgtcgccgcg
cgccagcgcgagatcgccgccggcggccggcgcgctcggctcgagaccctgctcgagatc
ccagtcgtgaccgcccccgactggaacccggaggagatccaggccgagctcgacaacaac
tgccaggggatcctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctcgaag
gtaccggacatcgccgacgtcgggctgatggaggaccgcgcaacgctgcgcatctccagc
cagcatgtcgccaattggctgtatcacggcgtcgtcaccgaggcgcaggtcatggagacc
ctgcggcgcatggccgccatcgttgacggtcagaacgccgacgaccccttctaccgaccg
atggccccagggttcgacgggctcgccttccaggcggcccgcgacctgatcttcaacggc
cgcaacgtcccgaacggctacacggagccgaccctgcacgcgcggcgccgcgcgcgcaaa
acccagctgaagcgctga

DBGET integrated database retrieval system