KEGG   Thioflavicoccus mobilis: Thimo_1054Help
Entry
Thimo_1054        CDS       T02397                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thimo_1054
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thimo_1054
   00630 Glyoxylate and dicarboxylate metabolism
    Thimo_1054
Enzymes [BR:tmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Thimo_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1139937..1142114)
Genome map
AA seq 725 aa AA seqDB search
MTERVTTGGLRVAQPLYDLITDEIAPGTGIDPGHFFAQLDEIVRDLAPRNRALLEVRDAM
QAQLDTWHRTHRGQTHDVDAYRAFLAEIGYLVPEGEGFTVTTANVDPEIARIAGPQLVVP
VSNPRYALNAANARWGSLYDALYGSDVVPEEDGCERRADYNPRRGAAVVAYANRLLDEAA
PLVRGSHADAAGYRIETGQLIVQLPDNSTTSLADPDRLAGYQGPAEAPSAVLLVHHGLHI
EIQIDRTHPIGQASVAGVKDLVLESAVTTIQDFEDSVAAVDTADKVAVYRNWLGLMRGDL
SAEFSKGGCMMTRTLEPDRRYTRPDGGELRLPGRSLMLVRNVGHLMTTDAVLTADGEEIP
EGILDGMVAAFAALHDLQGLGRYRNSAAGSLYIVKPKMHGPDEVAFTVELFARIEAALGL
EGNRLKVGIMDEERRTTLNLEACIRAARERVIFINTGFLDRTGDEIHSVMEAGPVYRKGD
MKSAPWLLAYEDWNVDLGLACGLPGHAQIGKGMWTMPDRMQGMVATKQAHPQAGASCAWV
PSPTAATLHALHYHQVDVAARQREIAAGGRRARLETLLEIPVVTAPDWNPEEIQAELDNN
CQGILGYVVRWIDQGVGCSKVPDIADVGLMEDRATLRISSQHVANWLYHGVVTEAQVMET
LRRMAAIVDGQNADDPFYRPMAPGFDGLAFQAARDLIFNGRNVPNGYTEPTLHARRRARK
TQLKR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcgtcaccaccggcggcctgcgcgtcgcccaacctctctacgacctcatc
accgacgagatcgcccctggcacgggcatcgaccccgggcacttcttcgcccagctcgac
gagatcgtccgcgacctggcgccgcgcaaccgcgcgctcctagaggtgcgcgacgccatg
caggcgcaactcgacacctggcatcgcacccatcgcggccaaacgcacgacgtcgatgcc
taccgcgccttcctcgccgagatcggctacctggtcccggagggcgaggggttcacggtg
acgaccgccaacgtcgaccccgagatcgcccggatcgccggtccacagctcgtcgtgccc
gtcagcaacccacgctatgccctgaacgccgccaacgcacgctggggcagcctctacgac
gccctctacggcagcgacgtggtcccggaggaagacggctgcgagcgccgcgccgactac
aacccgcgccgcggcgcggcggtcgtcgcctacgccaaccgcctcctcgacgaggccgca
ccgctggtgcgcggttcccacgccgacgccgccggctaccggatcgagacaggccaactc
atcgtccaactgccggacaacagcaccacctcgctcgccgacccggaccggctggccggc
taccagggcccggccgaggcgccgagcgcggtcctgctcgtccaccacggcctgcacatc
gagatccagatcgaccgcacccacccgatcggccaggcgagcgtcgcgggcgtcaaggac
ctggtgttggaatcggccgtcacgaccatccaggacttcgaggactcggtcgcagccgtt
gataccgccgacaaggtcgccgtctaccgcaactggctcgggctgatgaggggggatttg
agcgccgagttcagcaagggcggatgcatgatgacgcgcacgctggaaccggaccgccgc
tatacgcggcccgacggcggcgaactgcggctgccgggccgctcgctgatgctggtgcgc
aacgtcggccacctgatgacgaccgatgcggtcttgaccgccgacggcgaggagatcccc
gaggggatcctcgacggcatggtcgccgccttcgccgccctgcacgacttgcagggcctc
ggccgctaccgcaactcggcggcgggcagcctctacatcgtcaagccgaagatgcacggc
cccgacgaggttgccttcacggtcgagctcttcgcgcgcatcgaagcggcgctcgggctc
gagggcaacaggctcaaggtcggcatcatggacgaagagcggcgcacgacgctgaacctc
gaggcctgcatccgtgccgcccgcgagcgggtgatcttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccattcggtcatggaggccggcccggtctaccgcaagggcgac
atgaagtcggccccctggctcctcgcctacgaggactggaacgtcgatctcggcctcgcc
tgcggactgccgggccatgcccagatcggcaagggcatgtggacgatgcccgatcgcatg
caggggatggtcgcgaccaagcaggcccacccgcaggccggcgcgagctgcgcctgggtg
ccctcgccgaccgccgcgaccctgcacgccctgcactaccaccaagtcgacgtcgccgcg
cgccagcgcgagatcgccgccggcggccggcgcgctcggctcgagaccctgctcgagatc
ccagtcgtgaccgcccccgactggaacccggaggagatccaggccgagctcgacaacaac
tgccaggggatcctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctcgaag
gtaccggacatcgccgacgtcgggctgatggaggaccgcgcaacgctgcgcatctccagc
cagcatgtcgccaattggctgtatcacggcgtcgtcaccgaggcgcaggtcatggagacc
ctgcggcgcatggccgccatcgttgacggtcagaacgccgacgaccccttctaccgaccg
atggccccagggttcgacgggctcgccttccaggcggcccgcgacctgatcttcaacggc
cgcaacgtcccgaacggctacacggagccgaccctgcacgcgcggcgccgcgcgcgcaaa
acccagctgaagcgctga

DBGET integrated database retrieval system